KEGG   Anolis carolinensis (green anole): 100565100Help
Entry
100565100         CDS       T01608                                 

Gene name
irs1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  
insulin receptor substrate 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Autophagy - animal
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100565100 (irs1)
   04150 mTOR signaling pathway
    100565100 (irs1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100565100 (irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100565100 (irs1)
   04920 Adipocytokine signaling pathway
    100565100 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 1196 aa AA seqDB search
MASPTDLHHHSEGFFSDVRKVGYLRKPKSMHKRFFVLRAASELGPARLEYYENEKKWRHK
SGAPKRSIPLESCFNINKRADSKNKHLVALYTKDEHFAIAADSEPEQESWYQALLQLHNR
AKSHHHQHHHHHHYHGDVTVGGGNIGMGEAGEDSYGDMAPGPAFKEVWQVILKPKGLGQT
KNLIGIYRLCLTNKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTGPGEF
WMQVDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRSRHHVNNPPPS
QVGLSRRSRTESVTATSPAGSGVGGGAGGKPNSFRVRASSDGEGTMSRPASVDGSPVSPS
ANRTHSHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPR
RSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGDEDLNNYICMGG
KAVSSCCSITAPNGQFAPRPCHPQQQKPYTPCCPRLGSEDVGDVEKGFRKRTHSAGTSPT
ISHQKTPSQSSVASIEEYTEMLPSYSCGGSRLPSFRHSAFVPTHSYPEECIEMHQMEGNH
HRTNSTPHTDDGYMPMLPGVAPLPNGGNTSKGGDYMPMSPKSVSAPQQIINPGRGGRHVQ
AMVDSNGYMMMSPSGSCSPDSGPSGYSKLWLNGTSHHPKLSVESNEGKLPTGGSDYINMS
PASGSATSTPPDCFFTGSGTPGPEEPSVQGPTQSHHKPIYSYFSLPRSFKHMQRRTGEEA
NTQMRLSFSSGRLLYAAAEDSSSSTSSDSLGGPGGQEGVGYSVLTQPLQQPAPSCPVDTA
TLAKSRLARPTRLSLDGTKASTLPRAREQLPEPKSPGEYVNIEFKQPPFPSPLPHGDTGS
SSEEYMNMDWRTACPASLAPGQASQGGVGHIGGRDYRSMQLGSGGHYVVCAHTPSPSPPA
VLLSYADMRMGRGRPEKSTPPMGLPSPHPQAQPGDLASVLPHSCSSSMIGGPGMTSAFTH
VSLSPSHSTQSAKVIRADPQGGRRRHSSETFVSSTTPSGGLGAPAVPHGPGGGPDDVKRH
SSASFENVWLKPISGELGSSSGHRMAIRREQIAGGTGGGTENGLNYIDLDLVKDFNRHQH
PHPQESTSLLGVKQPTQQQQQHQPPKSPNQPCGSSHLSDELSAYASISFHKREDTQ
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccccaccgatcttcatcaccacagcgagggcttcttctccgatgtcaggaag
gtgggttacttgcgcaaacccaagagcatgcacaagcgtttcttcgtgctgagggcagcc
agtgagttggggcctgcccgcctggaatattatgagaatgaaaagaaatggagacacaaa
tcaggggccccaaagcgttcgatccctctggagagctgcttcaacatcaacaagagggca
gactccaaaaacaagcatttggtggctctctacaccaaggacgagcactttgccattgct
gctgacagtgagcctgaacaggagagttggtaccaggcgctgctgcaactgcacaaccga
gccaagagccaccatcaccagcatcatcaccatcaccactaccatggggatgttaccgtg
gggggtgggaatattggaatgggagaggcaggagaggatagctatggtgacatggctcct
ggcccagcgttcaaagaagtttggcaagtgatcttgaaacccaaaggtctgggccagact
aagaacctgattggcatctaccgcttgtgcctaaccaacaaaaccatcagttttgtcaag
ttgaactctgacgcggcagcggtggtgctgcagctgcttaacatccggcggtgtggccac
tctgagaactttttcttcattgaggtggggcgctctgcagtcactggaccaggtgagttc
tggatgcaggtagatgactcagtggtagcacagaatatgcatgagaccatcttggaggct
atgcgggcaatgagtgaagagttccgacctcgtagcaaaagccagtcttcttctaattgc
tccaatcctatttctgtgcctctccggagcaggcatcatgtcaacaacccaccacccagt
caggtggggctcagccgtaggtctaggacagaaagtgtgactgctacctcccctgctggc
agtggagtgggaggtggggcagggggaaagcccaattctttccgtgtccgagcatccagt
gatggagaaggcacaatgtcaaggccagcatcagtggatggaagtccagtgagtcctagt
gcgaatcggacccactcacataggcaccgcggcagctccagacttcatcctcctctcaac
cacagtcgctccatcccaatgccttcctcacgttgctctccttctgccacaagccccgtc
agcctctcatccagcagtaccagtggtcatggctccacttcagactgcctgtttccacgt
cggtccagtgcttcagtctcaggctcccccagtgatgggggcttcatctcctctgatgag
tatggatcaagtccttgtgacttccgcagctctttccgaagtgtaacccctgattccctg
ggacacacaccaccggccaggggagatgaggatcttaacaactatatatgcatgggaggg
aaagctgtctcttcctgctgcagcatcactgctcctaatgggcaatttgccccacgccct
tgccaccctcagcagcaaaaaccctatactccttgctgtccccggcttggcagtgaggat
gtgggtgatgtggagaaaggtttcaggaaacggacacattcagctggcacttcccctacc
atctcccaccagaagaccccctcgcagtcttcagtagcttccattgaagaatatactgag
atgctcccctcatattcctgtggtggtagcaggctcccttcttttcgacattctgctttt
gtgccaacccattcttaccctgaagagtgtatagaaatgcaccaaatggagggtaaccac
caccggaccaactctaccccacacactgatgatggctacatgccaatgttgccaggagtt
gctcctttgcctaatggtggaaatacttccaaaggtggtgattatatgcccatgagtccc
aagagtgtgtctgccccacagcagatcatcaaccctggaagaggaggccgccatgtccaa
gccatggtggactccaatggctacatgatgatgtctccaagtggcagttgttctccagat
agtggtcccagtggttacagcaaactctggctgaatgggacaagtcatcaccccaaactt
tcggtggagagcaatgaggggaagctgccaactggtggcagtgattacattaacatgtct
ccagccagtggctctgctaccagcacccctccagattgcttcttcactggctcaggaact
ccaggcccagaagaaccatcagtgcagggtcccacccagtcccaccacaagcccatttat
tcctacttctccctgccacgctccttcaagcacatgcaacgtaggaccggtgaagaggca
aatactcagatgcgcctgtccttcagttctggccgcttgctgtatgctgctgctgaggac
tcttcctcatccactagtagtgatagccttggtggccctgggggacaggagggtgttggg
tattctgttcttacacagccattacagcagcctgctccttcttgtcctgtggacacagca
acgctggccaagagccgtttggctagacctacccgtctgtccttggatggcacaaaggcc
agcactttgcctcgtgctagggaacagctcccggagcccaaaagccctggtgagtatgtg
aacattgaattcaagcagccgcccttcccatcacctctgcctcatggagatactggctcc
agttctgaggagtatatgaatatggactggaggactgcctgcccagccagcttagcacca
gggcaggcaagccagggaggggtgggccacattggtggccgagactataggagcatgcaa
ttgggcagcggagggcactatgtggtttgtgcccataccccctctccttctcctccagct
gttctgctcagttatgctgatatgaggatgggtcgtggtaggccagagaaaagcacacct
cctatggggctgccctcccctcatcctcaggcccagccaggggatttggcttcagtcttg
ccccactcctgttcttcatccatgattgggggcccaggaatgaccagcgcctttacacat
gtcagcctcagccctagccacagcacccagagtgccaaagtgatccgtgctgacccccag
ggaggccggcgacgccatagttctgagacttttgtttcctccaccacccctagtggtggc
ctgggggccccagctgtaccccatggtcctggaggggggcctgatgatgtgaagcgccac
agctcagcttcttttgaaaatgtctggctgaagcccatatctggagagctgggatcttcc
tctggccaccgtatggcaatcaggagggagcagatagctggcgggactggaggaggtact
gaaaatggcctcaattacattgacttggacttagtgaaggattttaatcgccaccaacat
cctcatcctcaggagagcacttccctgctaggggtcaagcagccaacgcagcagcaacag
cagcaccagccacctaaatctccaaatcagccttgtgggagtagccacttgagtgatgaa
ttaagtgcatatgccagcattagcttccacaagcgggaggacacccagtag

DBGET integrated database retrieval system