KEGG   Anolis carolinensis (green anole): 100565100Help
Entry
100565100         CDS       T01608                                 

Gene name
irs1
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100565100 (irs1)
   04150 mTOR signaling pathway
    100565100 (irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100565100 (irs1)
   04920 Adipocytokine signaling pathway
    100565100 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1196 aa AA seqDB search
MASPTDLHHHSEGFFSDVRKVGYLRKPKSMHKRFFVLRAASELGPARLEYYENEKKWRHK
SGAPKRSIPLESCFNINKRADSKNKHLVALYTKDEHFAIAADSEPEQESWYQALLQLHNR
AKSHHHQHHHHHHYHGDVTVGGGNIGMGEAGEDSYGDMAPGPAFKEVWQVILKPKGLGQT
KNLIGIYRLCLTNKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTGPGEF
WMQVDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRSRHHVNNPPPS
QVGLSRRSRTESVTATSPAGSGVGGGAGGKPNSFRVRASSDGEGTMSRPASVDGSPVSPS
ANRTHSHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPR
RSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGDEDLNNYICMGG
KAVSSCCSITAPNGQFAPRPCHPQQQKPYTPCCPRLGSEDVGDVEKGFRKRTHSAGTSPT
ISHQKTPSQSSVASIEEYTEMLPSYSCGGSRLPSFRHSAFVPTHSYPEECIEMHQMEGNH
HRTNSTPHTDDGYMPMLPGVAPLPNGGNTSKGGDYMPMSPKSVSAPQQIINPGRGGRHVQ
AMVDSNGYMMMSPSGSCSPDSGPSGYSKLWLNGTSHHPKLSVESNEGKLPTGGSDYINMS
PASGSATSTPPDCFFTGSGTPGPEEPSVQGPTQSHHKPIYSYFSLPRSFKHMQRRTGEEA
NTQMRLSFSSGRLLYAAAEDSSSSTSSDSLGGPGGQEGVGYSVLTQPLQQPAPSCPVDTA
TLAKSRLARPTRLSLDGTKASTLPRAREQLPEPKSPGEYVNIEFKQPPFPSPLPHGDTGS
SSEEYMNMDWRTACPASLAPGQASQGGVGHIGGRDYRSMQLGSGGHYVVCAHTPSPSPPA
VLLSYADMRMGRGRPEKSTPPMGLPSPHPQAQPGDLASVLPHSCSSSMIGGPGMTSAFTH
VSLSPSHSTQSAKVIRADPQGGRRRHSSETFVSSTTPSGGLGAPAVPHGPGGGPDDVKRH
SSASFENVWLKPISGELGSSSGHRMAIRREQIAGGTGGGTENGLNYIDLDLVKDFNRHQH
PHPQESTSLLGVKQPTQQQQQHQPPKSPNQPCGSSHLSDELSAYASISFHKREDTQ
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccccaccgatcttcatcaccacagcgagggcttcttctccgatgtcaggaag
gtgggttacttgcgcaaacccaagagcatgcacaagcgtttcttcgtgctgagggcagcc
agtgagttggggcctgcccgcctggaatattatgagaatgaaaagaaatggagacacaaa
tcaggggccccaaagcgttcgatccctctggagagctgcttcaacatcaacaagagggca
gactccaaaaacaagcatttggtggctctctacaccaaggacgagcactttgccattgct
gctgacagtgagcctgaacaggagagttggtaccaggcgctgctgcaactgcacaaccga
gccaagagccaccatcaccagcatcatcaccatcaccactaccatggggatgttaccgtg
gggggtgggaatattggaatgggagaggcaggagaggatagctatggtgacatggctcct
ggcccagcgttcaaagaagtttggcaagtgatcttgaaacccaaaggtctgggccagact
aagaacctgattggcatctaccgcttgtgcctaaccaacaaaaccatcagttttgtcaag
ttgaactctgacgcggcagcggtggtgctgcagctgcttaacatccggcggtgtggccac
tctgagaactttttcttcattgaggtggggcgctctgcagtcactggaccaggtgagttc
tggatgcaggtagatgactcagtggtagcacagaatatgcatgagaccatcttggaggct
atgcgggcaatgagtgaagagttccgacctcgtagcaaaagccagtcttcttctaattgc
tccaatcctatttctgtgcctctccggagcaggcatcatgtcaacaacccaccacccagt
caggtggggctcagccgtaggtctaggacagaaagtgtgactgctacctcccctgctggc
agtggagtgggaggtggggcagggggaaagcccaattctttccgtgtccgagcatccagt
gatggagaaggcacaatgtcaaggccagcatcagtggatggaagtccagtgagtcctagt
gcgaatcggacccactcacataggcaccgcggcagctccagacttcatcctcctctcaac
cacagtcgctccatcccaatgccttcctcacgttgctctccttctgccacaagccccgtc
agcctctcatccagcagtaccagtggtcatggctccacttcagactgcctgtttccacgt
cggtccagtgcttcagtctcaggctcccccagtgatgggggcttcatctcctctgatgag
tatggatcaagtccttgtgacttccgcagctctttccgaagtgtaacccctgattccctg
ggacacacaccaccggccaggggagatgaggatcttaacaactatatatgcatgggaggg
aaagctgtctcttcctgctgcagcatcactgctcctaatgggcaatttgccccacgccct
tgccaccctcagcagcaaaaaccctatactccttgctgtccccggcttggcagtgaggat
gtgggtgatgtggagaaaggtttcaggaaacggacacattcagctggcacttcccctacc
atctcccaccagaagaccccctcgcagtcttcagtagcttccattgaagaatatactgag
atgctcccctcatattcctgtggtggtagcaggctcccttcttttcgacattctgctttt
gtgccaacccattcttaccctgaagagtgtatagaaatgcaccaaatggagggtaaccac
caccggaccaactctaccccacacactgatgatggctacatgccaatgttgccaggagtt
gctcctttgcctaatggtggaaatacttccaaaggtggtgattatatgcccatgagtccc
aagagtgtgtctgccccacagcagatcatcaaccctggaagaggaggccgccatgtccaa
gccatggtggactccaatggctacatgatgatgtctccaagtggcagttgttctccagat
agtggtcccagtggttacagcaaactctggctgaatgggacaagtcatcaccccaaactt
tcggtggagagcaatgaggggaagctgccaactggtggcagtgattacattaacatgtct
ccagccagtggctctgctaccagcacccctccagattgcttcttcactggctcaggaact
ccaggcccagaagaaccatcagtgcagggtcccacccagtcccaccacaagcccatttat
tcctacttctccctgccacgctccttcaagcacatgcaacgtaggaccggtgaagaggca
aatactcagatgcgcctgtccttcagttctggccgcttgctgtatgctgctgctgaggac
tcttcctcatccactagtagtgatagccttggtggccctgggggacaggagggtgttggg
tattctgttcttacacagccattacagcagcctgctccttcttgtcctgtggacacagca
acgctggccaagagccgtttggctagacctacccgtctgtccttggatggcacaaaggcc
agcactttgcctcgtgctagggaacagctcccggagcccaaaagccctggtgagtatgtg
aacattgaattcaagcagccgcccttcccatcacctctgcctcatggagatactggctcc
agttctgaggagtatatgaatatggactggaggactgcctgcccagccagcttagcacca
gggcaggcaagccagggaggggtgggccacattggtggccgagactataggagcatgcaa
ttgggcagcggagggcactatgtggtttgtgcccataccccctctccttctcctccagct
gttctgctcagttatgctgatatgaggatgggtcgtggtaggccagagaaaagcacacct
cctatggggctgccctcccctcatcctcaggcccagccaggggatttggcttcagtcttg
ccccactcctgttcttcatccatgattgggggcccaggaatgaccagcgcctttacacat
gtcagcctcagccctagccacagcacccagagtgccaaagtgatccgtgctgacccccag
ggaggccggcgacgccatagttctgagacttttgtttcctccaccacccctagtggtggc
ctgggggccccagctgtaccccatggtcctggaggggggcctgatgatgtgaagcgccac
agctcagcttcttttgaaaatgtctggctgaagcccatatctggagagctgggatcttcc
tctggccaccgtatggcaatcaggagggagcagatagctggcgggactggaggaggtact
gaaaatggcctcaattacattgacttggacttagtgaaggattttaatcgccaccaacat
cctcatcctcaggagagcacttccctgctaggggtcaagcagccaacgcagcagcaacag
cagcaccagccacctaaatctccaaatcagccttgtgggagtagccacttgagtgatgaa
ttaagtgcatatgccagcattagcttccacaagcgggaggacacccagtag

DBGET integrated database retrieval system