KEGG   Anolis carolinensis (green anole): 100565106Help
Entry
100565106         CDS       T01608                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100565106
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100565106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 560 aa AA seqDB search
MIAGVQAISGTLQGVTQLHIMKRTQALFSKECKRLLRRMPPIGRDNKKGLLLLLLAAFGL
CWMHYKSDPKPVRTSIVHLFEWRWTDVADECERYLAPNGFAGVQVSPPNENLVIMTPWRP
WWERYQPISYKLCSRSGNENEFRDMVTRCNNVGINIFVDAVINHMCGSGAGSGHRGTCES
YFNAGVRYFPAVPYFTFDFNDRICKTPSGDIENYSDPIQVRNCRLSGLVDLAQSREDVRS
KIAGYMNHLIDLGVAGFRIDASKHIWPKDINAILSKVNNLNTRWFTKGSRPFIYQEVIDL
GGEGVQSSEYFRNGRVTEFRYGMQLGTVLHKWNGEKMANLKSLGENWSLMPSDKAIVFVD
NHDNQRGHGAGGASILTFWNPRLYKMAVGFMLAHPYGFTRIISSYRWPRDIQHGKDLNDW
VGPPSNSDGTIKPVTINPDGSCGNGWVCEHRWTQIRNMVIFRNVVHRQPITNWWDNNNNQ
IAFGREAKGFIVFNNDDRNLSISLPTGLPAGIYCDVISGQKEGNLCTGIQIHIAASGVGD
FQINSQAEDPFIAIHVEAKL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctggagtccaagcaatctcagggacattacaaggtgtgactcagctacatata
atgaaaagaacacaagctcttttctctaaggaatgcaaaaggctcttgagaagaatgcca
ccgattggcagagacaacaagaagggcttattgctccttctccttgcagcctttggactt
tgctggatgcattacaaatcagatcccaaacctgtaaggacgtctattgtccaccttttc
gaatggcgctggacagatgtggctgatgaatgtgaacgttatttagcaccaaatggattt
gcaggagttcaggtttctcctcccaatgaaaatctggttataatgactccatggagacca
tggtgggaaaggtatcagcctatcagttacaaattgtgttcacgttctggaaatgaaaat
gaatttcgagacatggtgacaagatgcaacaatgttggaataaatatttttgtggatgct
gtgatcaatcatatgtgtggctctggggctggctctggacaccgtgggacctgtgagagc
tatttcaatgctggtgtgcgatatttccctgctgtcccctactttacctttgatttcaat
gaccgaatatgtaagacaccaagtggggatattgaaaattacagtgatcctatccaggtt
cgcaactgccgtctatctggtcttgttgaccttgcacaaagcagagaagatgtacgttca
aaaatagctggatacatgaatcacttgattgatctgggtgttgcagggttccgaattgat
gcttcaaagcacatatggcccaaagacattaatgctatcttaagcaaagtaaacaatcta
aacacacggtggtttaccaaaggttcacggcctttcatctaccaggaggtaattgactta
ggtggcgaaggtgtccaaagctccgaatacttcagaaatggtcgagtgactgaatttaga
tatggcatgcaacttggaactgtcctccacaaatggaatggggagaagatggcaaatttg
aagagcttgggagaaaattggagtttgatgccctctgacaaagccattgtctttgtagat
aaccatgacaaccagaggggacatggtgctggtggagcctccatcctcactttttggaac
cccagactctataaaatggcagttgggtttatgcttgctcatccctatgggtttacaaga
ataatatcaagctacaggtggccgagagatatccagcatggaaaggacttgaatgactgg
gttggaccacctagcaatagtgatggaacaattaaacctgttacaattaatcctgatggc
agttgtgggaatggctgggtctgtgaacatcgttggactcaaatacggaatatggtgatt
ttccgaaatgttgtacatcgtcagcctattacaaactggtgggacaacaataacaaccag
atagcatttgggcgtgaagccaaaggatttattgtgtttaataacgatgacaggaacttg
tcgataagcctcccaacgggtcttcctgctggcatttactgtgatgttatttccggacaa
aaggaaggcaacctctgcactggaattcaaatccacatcgctgccagtggtgtgggtgat
tttcagattaatagccaagctgaagatccattcattgcaattcatgttgaagccaaattg
taa

DBGET integrated database retrieval system