KEGG   Anolis carolinensis (green anole): 100565122Help
Entry
100565122         CDS       T01608                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 2-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100565122
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100565122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 408 aa AA seqDB search
MRLLRCLLKGQSALAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPV
RLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMVFLDKDPEDSAALGQFTNALVTI
RNRHNDVVPTMAQGVIEYKEAYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGS
TNPAHPKHIGSIDPNCNVSEVVRDAYDMAKLLCDKYYMTSPDLEIQEVNANQLDQSIHMV
YVPSHLYHMLFELFKNAMRATVESHESSPRLPPIKVMVALGNEDLSIRMSDRGGGVPLRK
IERLFSYMYSTAPKPELGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIY
LKALSTDSVERLPVYNKSAWRHYQTIQEADDWCVPSTEPKNTSTYRVT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcctgcggtgcctcttaaagggccagtcggctctggccggcgcacccaagtac
atcgagcacttcagcaaattctcgccgtcgccgctctccatgaagcagttccttgacttc
gggtccagtaatgcctgcgagaagacctcattcactttccttcgtcaagaacttcctgtc
cggcttgccaacatcatgaaggaaatcaatcttctcccagatcgagtgctgagcacccct
tctgttcagttggtgcagagctggtatgtgcagagtttgctggacatcatggtgttcctg
gataaggaccctgaagattctgcggcccttggacaattcaccaatgccctggtcacaatt
cgaaaccgtcataacgatgtagtccccaccatggcacagggtgtgattgagtacaaggag
gcttatggggatgaccctgtctccaaccagaacatccaatatttcctggaccgcttctac
cttagccgcatctccattcgtatgctcattaatcaacataccttgatttttgatggcagc
accaacccagcccatcccaagcacatcggcagcattgatcccaactgcaatgtttcagag
gtagttagagatgcgtatgacatggccaagctgttgtgtgacaaatattacatgacttct
cctgacttagagatccaggaagtaaatgctaaccagctcgaccagtccatccacatggtt
tatgtcccatctcacttgtaccacatgctctttgaactgttcaagaatgccatgagagcc
actgttgaaagccatgaatccagccccagattgccacccataaaagtaatggtggcattg
gggaatgaagatctctctatcaggatgagcgaccgaggaggtggagtccctctccggaag
attgaacggctcttcagctacatgtattccacagcacccaaaccagaactgggcactggt
gggacacccttggctggctttggctatgggctgcctatttcccgactctatgccaagtat
ttccaaggtgaccttcaactcttttccatggagggctttggaacagatgctgtcatctac
ttgaaagccttgtcaacggactctgtggagaggcttccagtgtacaacaagtcggcttgg
cgtcactaccaaactatccaggaagctgacgattggtgtgttcccagtactgaaccgaag
aacacatctacttaccgggtgacctaa

DBGET integrated database retrieval system