KEGG   Anolis carolinensis (green anole): 100565169Help
Entry
100565169         CDS       T01608                                 

Gene name
usp9x
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 2552 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIELSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLAQDWFPLLELLAMALNP
HCKFHLYNGTRPSETVPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FMSGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMESMRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GSDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHISLVVRFPNQGRQVE
DLDVWSHTNDTIGSVRRCILNRIKANSAHTKVELFIGGELVDPVDDRKLIGQLNLKDKTL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVEGCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARILMKLMPPDNTTVEKLRAICLDHAKLGDSSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPANLPLGEDATDFQFNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPAVEGTSPMSPINQATHDQAVVLQT
ALQNIPNPTSECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGCGSVQLVFSS
NEDISKIYEKTNAGNEPDAEDEQVCCEALEAMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKSVRQMAQEQFFLMATRCCMGQRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDTLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPAIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDEVFGY
PHQYEDKPTLSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQLIQNEQSENEHSGST
KYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCF
GGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTLDKDNELIKYISELTMTTKPHQI
KMPSAIERSVRKQNVQFMHNRMQYSLEYFQFVKKLLTCNSVYLNPPPGQDHLLPEAEEIT
MISVQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFS
EYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSTQAFDNLSLSDHLLRAVL
NLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVALDEGPGPPIKYQ
YAELGKLYTVVSQLIRCCNVSSRMQSSINGNPPLSNPYGDPNLSQPIMALQQNVADILFV
RTSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLL
QILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVA
YQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSH
SARMTLAKACELCPEEEPDDPDAPDEHESSPPEDAPLYPHSPGSQYQQNNHVHGQPYTGP
AAHHMNNPQRPGQRAQENFEGSEEVSPPQTKE
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgacccgtggctctccagttggagggaatgacagtcagggtcaggctcct
gatggacagtcccaacctcctctccagcagaatcagacgtcttcacctgattcttcaaat
gagaattccccagctactccccctgatgaacagggtcaaggtgatgccccacctcaactt
gaagatgaagagcctgcatttccacacactgacctggccaagttggatgacatgattaac
agacctcggtgggttgttcctgtattgcctaaaggggaattagaagtgcttctagaagct
gctattgaacttagtaaaaaaggccttgatgtcaaaagtgaagcatgtcaacgatttttt
cgagatggcctaacaatctctttcacaaaaatccttacggatgaagcagtgagtggttgg
aagtttgaaatccatagatgtataattaacaacactcaccgtctagttgaactctgtgtg
gcaaagctggcccaagattggtttcctcttcttgaacttcttgctatggccttaaatcct
cattgcaaattccatctttacaatggtacacgcccctctgaaactgttcctgctggagtt
cagttggctgaagatgaactttatgctcgtcctccagacccacggtcaccgaagggttgg
ctagtagatctcatcaacaagtttggcacattaaatgggtttcagatcctacatgatcgt
tttatgagtggatcagcactgaatgttcagattattgcagctctcatcaaaccatttgga
cagtgctatgagtttctgacactgcatacagtgaagaaatacttcctccccattatagaa
atggttccacagtttttagaaaacttaactgatgatgaactcaaaaaagaagccaagaat
gaagccaaaaatgacgcattgtcaatgataattaaatcattaaagaacttagcctcgcga
gtaccaggacaagaggaaactgtaaaaaatttagaaatatttagattaaaaatgattctt
aggttgttgcaaatttcatctttcaatggaaaaatgaatgcactaaatgaagttaacaag
gtaatatctagtgtgtcatattatactcatcgacatggcaatcctgaagaagaggagtgg
cttactgcagaaagaatggcagagtggattcagcaaaataatatattatcgattgtgtta
agggatagtctacatcaacctcagtatgtagaaaaattagaaaaaattcttcgttttgtc
atcaaagaaaaggccctcactttgcaagatcttgacaacatttgggctgcacaggcaggg
aaacatgaagccattgtgaagaatgtacatgacctccttgcaaaattggcctgggatttc
tctcctgaacaacttgaccatctctttgattgttttaaggcaagttggacaaatgcaagc
aaaaagcagcgtgaaaagctacttgaactaattcgtcgccttgcagaagatgataaagat
ggagtgatggcacacaaagtactaaaccttttatggaatttagcacatagtgatgatgtt
ccagttgatatcatggaccaggctctcagtgcccacattaaaatcttagattatagttgc
tctcaggatcgagacacacaaaaaatacaatggatagatcgttttatagaagagcttcgc
acaaatgacaaatgggtcattcctgcactgaaacaaattagagaaatttgtagtttattt
ggtgaagctccacagaatttgagtcaaactcagcgaagcccccatgtgttttatcgccat
gacttaatcaatcaacttcagcacaatcatgctttagtaactttagttgcagaaaatctt
tcagcatatatggaaagcatgagacagtatgctaaagaacatggagaatatgatccacaa
actgtaagaccagggagtagatatagtcatgtgcaagaagttcaagagcggctaaacttc
ctacgatttttactgaaggatggtcagctatggctctgtgctcctcaggcaaaacaaata
tggaaatgtttagctgaaaatgcagtctacctgtgtgatcgtgaagcctgttttaaatgg
tattctaaactcatgggagatgagccagatttagacccagacataaataaagacttcttt
gaaaacaatgttcttcagctggacccttcactcttaacagaaaatggaatgaaatgtttt
gaacgtttcttcaaagctgtaaactgtcgagaagggaagcttgttgcgaaaagacgggcc
tatatgatggatgacttggaactaattggattggattatctttggagggttgtcattcaa
ggaagtgatgatattgctagtcgagcaatagatctactaaaggaaatctataccaatctt
ggcccaaggttacaagttaatcaggtagttatccatgaagacttcattcagtcctgcttt
gatcgtttgaaggcatcttatgatactctatgtgttctggatggagataaagacagtatt
aattgtgcaagacaagaagcgatacgaatggtgcgagtgttgactgttttaagagagtat
ataaatgaatgtgacagtgattaccatgaagagcgaacaattctaccaatgtcaagggct
tttcgtggaaaacacatctctcttgtagttcgatttccaaaccaaggtcggcaagtggaa
gatttggatgtttggtcccacacaaatgacaccattggatctgtgaggcgttgcattctc
aatcgcattaaagcaaacagtgcgcatacaaaagtagaattgttcattggaggcgagcta
gtagatcctgtagatgacagaaaattaattggacagctaaatctcaaagataaaacgcta
attacagccaagcttacacaaataagttccaatatgccttcaagtcctgatagttcttct
gattcctctactggttctcctggcaaccatggcaatcattatagtgatggtccaaatcca
gaagttgaaggttgtttgcctggagttatcatgtcattgcatcctagatacatctctttc
ctttggcaagttgcagacctaggcagtagcctaaatatgccacctcttagagatggtgca
cgtatcctaatgaaattaatgccaccagataacacaactgtagagaagttaagagctata
tgtttagaccacgcaaaacttggtgatagcagccttagtccatcccttgattctcttttc
tttggtccttctgcctcacaagtgctatatctgacagaggtagtttatgccttgttaatg
cctgccaatttacctctgggagaagatgctactgactttcagtttaacttcttaaaaagt
ggtggtttgcctcttgtgctgagtatgctgaccaggaataactttctgccaaatgcagat
atggagacaagaagaggcgcctacttaaatgctctaaaaatagcaaaactgttgctaact
gcaatcggctatggccatgtgagagctgtggcagaagcatgtcagccagctgtagaaggc
acaagtccaatgtcaccgatcaatcaagcaactcatgaccaagcagtggtattgcagact
gctctccagaacattcccaatccaacatcagagtgcatgctaaggaatgttgcaatacgt
cttgcacagcaaatatctgatgaggcttccaaatatattcctgatatttgtgttattaga
gcagtgcaaaaaatagtttgggcttcaggatgtggatcagtacagctggtattcagctca
aatgaggatattagtaaaatctatgagaagactaatgctggaaatgaaccagatgcagaa
gatgaacaagtttgctgtgaagcacttgaagcgatgactctttgttttgccttgattcca
acagcattggatgcacttagtaaagaaaaagcatggcagacatttatcattgacttgcta
ttgcactgccatagcaaaagcgttcgtcagatggcacaagagcagttcttcttaatggct
accagatgttgtatgggacaaagaccccttcttttctttataactctgttatttactgta
ttagggagtactgcgcgggagcgtgctaagcattcaggggattactttactttactgagg
catcttcttaattatgcatacaatagtaatattaatgtacccaatgctgaagttctgctt
aacaatgaaattgactggcttaaaaggattagggatgaagtgaaaagaacaggagaaaca
ggtgtagaagagactattttagaaggacaccttggagtaacaaaggaattattggcattc
caaacccctgaaaaaaaataccatatagggtgtgaaaaaggaggtgctaatctcattaaa
gaactaatagatgatttcatctttcccgcttctaatgtttacttacagtacatgaggaat
ggggaattgcctgctgagcaggccataccagtttgtagttccccagccaccattaatgct
ggatttgagttgctagtagcactagcagtcggctgtgtccgaaacctcaagcaaatagta
gatactttgacggaaatgtactatataggcactgcaataactacttgcgaagcactaaca
gaatgggaatatttgccgcctgttggaccacgaccaccaaagggatttgtagggctaaaa
aatgccggtgccacttgttacatgaattctgtcattcagcaactgtatatgattcctgcc
atcaggaatgggatccttgcaattgagggcactggcagtgatgtagatgatgatatgtct
ggagatgagaagcaagacaatgagagcaatgttgatccacgagatgaagtatttggctat
ccacatcagtatgaagataaaccaactttaagtaaaacagaagacagaaaagaatacaat
ataggtgtattaagacaccttcaggtcatctttggtcacttagcagcttctaggttacaa
tactatgtaccaaggggtttttggaagcaattcaggctctggggtgaacctgtaaatcta
cgtgagcagcacgatgctttagaattttttaattctttggtggatagcttagatgaagct
ttaaaggccttaggacacccagcaatgctaagtaaagttttgggaggatcatttgctgat
cagaagatctgtcaaggctgtccacataggtacgaatgtgaagaatcttttacaactctg
aatgtagatataagaaatcaccaaaacctgcttgactccttggaacagtatgtcaaagga
gacttactagaaggtgcaaatgcgtatcattgtgaaaaatgcaataaaaaggttgataca
gtgaagcgcttactgattaaaaagctgcctccagttcttgccatccagctaaaacgattt
gactatgactgggaaagggaatgtgcaatcaaattcaatgattattttgaatttccacga
gagttggacatggaaccttatacagtggcaggagtagctaaattagaaggggatgatgta
aatccagaaaatcagctaatacagaatgagcaatctgaaaatgaacactctggaagtaca
aaatacagactagtgggtgtgttagtgcacagtggacaagccagtggtggacattactac
tcttacattattcagaggaacggtggagacggcgagaaaaacaggtggtataaatttgat
gatggagatgtaacagaatgcaaaatggatgatgatgaagaaatgaaaaatcagtgtttt
ggtggcgaatacatgggggaagtatttgatcacatgatgaagcgcatgtcatacagacgt
cagaagaggtggtggaatgcttacatccttttttatgaacgtatggacaccttagacaaa
gataacgaactaataaaatatatttcagaacttacaatgaccactaaaccccatcagatt
aaaatgccatctgccattgagcgaagcgtacggaaacaaaatgtacagttcatgcataac
cgaatgcagtacagcctagaatacttccaatttgtaaaaaaattactgacttgtaacagc
gtctacctgaatcctcctccaggacaagatcacctgttgcctgaagcagaagaaataaca
atgattagtgttcagcttgctgctagatttctttttaccacaggatttcacacaaagaaa
atagtccgtggccctgccagtgattggtatgatgctttatgcattctccttcgtcacagc
aagaatgtacgtttttggtttgcacacaatgtccttttcaatgtttcaaatcgcttttct
gaataccttttggaatgccctagtgctgaagtgaggggagcgtttgcaaagcttatagtg
ttcattgcacatttttcattacaagatgggccgtgtccttcacctttcgcttcaccagga
ccttctacacaggcctttgacaatttaagtttgagtgaccacttgctgagagctgtattg
aatcttcttagaagagaggtgtctgaacatgggcgtcatttgcagcaatatttcaacttg
tttgtgatgtatgccaatttaggtgtggcagaaaaaacacaacttttaaaactcaatgtg
cctgctacatttatgcttgtggcattggatgaaggccctggccctccgatcaaatatcaa
tatgctgaattgggtaaactgtacactgtggtgtcccaactaatccgttgttgcaatgtg
tcatcacgtatgcagtcttctatcaacggtaaccctccacttagcaacccatatggtgat
cctaatttatcacagccaataatggcacttcagcagaatgtggcagacattttgtttgtg
cgaactagttatgtgaaaaaaatcattgaggactgcagtaattctgaagaaaccatcaaa
ttgcttcgcttctgctgttgggaaaatcctcagttttcatctacagttctcagtgaacta
ctttggcaggttgcatattcatacacatatgaacttcgaccttacttggatctgctcttg
caaattttgctaattgaagactcttggcaaactcacaggattcacaatgcacttaaggga
attccagatgacagggatgggctgtttgatacaattcagcgctccaagaaccattatcaa
aaacgggcttaccagtgtataaaatgtatggtggctctcttcagcaactgtccagtagcc
taccagatcttgcagagcaatggagatttgaaaagaaaatggacttgggcagtagagtgg
cttggggatgagcttgagcgtaggccatacactggcaacccacaatatacttataacaac
tggtctccaccagtccagagtaatgaaacatcaaatggttactttctggagagatcacac
agtgcaagaatgacccttgcaaaggcttgtgagctgtgcccagaggaagagccagatgat
ccagatgcacctgatgagcatgagtcctctccacctgaagatgctccattgtatccccat
tcacctggatcccagtatcaacagaataaccatgtgcacggacagccctatacaggccca
gcagcacatcatatgaacaaccctcagcgacctggccaacgagcacaagaaaattttgaa
ggcagcgaagaggtttcaccccctcagacgaaagaatag

DBGET integrated database retrieval system