KEGG   Anolis carolinensis (green anole): 100565189Help
Entry
100565189         CDS       T01608                                 

Definition
prolactin receptor-like
Orthology
K05081  
prolactin receptor
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:acs04630]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:acs04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:acs04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 826 aa AA seqDB search
MRIHTSPSKTLTMLLSLSMWLVNGQSPPGKPTIIGCQLSGNESFTCRWESDSSGGLPKNY
SLLYLTERDEQLHECPDYISAGPNSCYFDKSYTRLWTTYNITVKATNDLGSNFSDPHSVD
MRTLGKPEPPLDLSLELRQLNETLYLWAKWSPPPSITDGAASWESCNYELQTNIDGGAKW
EIYAVGKRTQYKISQLRPDVKYTVQVRCVRDSGEASEWSPESYFKLHSGQPPGKPELIRC
RSPEKETFTCWWKPGSDGGLPNNYIFFYNKEGEDEFHECPDYTTAGPNSCYFSKKHTSIW
RTYNFTIKAMNEIGSTASDSYYVDVANIVQPDPPENLSLEFEKKVYGEYLLLKWSPPLLG
DLRSGWLTLDYELRIKPEEGQVWEKIFVGHRTTYKMYSLNPGERYVAQVRCRSDHGLWSD
WSPKSYIKLQKDVRVKDILVWIFVACLSFAVCLIMVCTLALKRTNMVARILPPIPRPKIK
GFDAQLLEAGKTEELLSALDCHGFPPTSDYDDLLVEFLEVDDSEDQQLMPSQEKKYPNST
HQDTDSDSGRGSCESPSLLSEKRKDARNPAELKTLDIEGVQKNAGIKSTPETSNIDCEGQ
LPWSSSGGPQASTWPGPQLPNYQTPNCFNKEITDVCKIALSAINGNRSPVLMESENTLHH
SQHPKTTETISKGAPTRLEDGTNLPLNVHGDQRALWLFPPVRLPSSSIKPMDYVEVHKVN
HDGVLAVFPKQKENAHKAEKSPAARDTNEYTKVSTVADNHILVLFPDPKMEALPSFQETP
KEPSQIYSQSQAEKSMGYCLSAPNAFKMQSGGLDYMDPNNFMPTFN
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcatacatcaccttcaaagacacttaccatgctcctttctttgagcatgtgg
cttgtgaatggtcaatcacctcctgggaagcctacaataataggttgccaattgtcagga
aatgaatcatttacctgtcgatgggaatctgattcaagtggaggacttcctaaaaattac
tctctactgtatctcacagaaagagatgaacagctccatgaatgtccagactacatatca
gcaggccccaattcgtgttattttgataaaagctacaccaggctttggaccacatacaat
atcacagtaaaagctaccaatgatttggggagtaatttctctgatcctcactctgtggac
atgcgaaccctaggtaagccagagcctcccttggatctttctctggagctcagacagttg
aacgagacactgtatttgtgggcaaaatggtcaccgccaccttcaataactgatggtgca
gcaagctgggaaagctgcaattatgagttgcaaacaaacatcgatggaggagcaaaatgg
gagatttatgctgtcgggaagcgaacacaatataaaatatctcagttgcgtccagatgtg
aaatatacagttcaggttcgctgtgtaagagatagcggggaggctagtgaatggagtcca
gaaagctacttcaaactccacagtggccaacctccagggaagccagagttaataagatgc
cgctctcccgaaaaagaaacctttacttgctggtggaaacctggttctgacggaggtctc
cctaataactacattttcttctataacaaggaaggagaggatgagttccacgaatgtcca
gactacacaactgcaggacccaattcttgttatttcagtaaaaagcatacttctatttgg
aggacatacaattttaccataaaggctatgaatgagataggaagtactgcctctgactct
tattatgtggatgtggctaacatagttcagccagatcctccagaaaacctgtctctggaa
tttgagaaaaaagtgtatggggagtatctcttgttgaaatggtctccaccgttgctgggt
gatctcagatccggctggctcacccttgactatgagttgcgcataaaaccagaagaaggg
caagtgtgggagaaaatatttgttggacatagaacaacttacaagatgtacagtttaaat
ccaggagaaagatatgttgcccaagtccgctgcaggtctgaccatggcttgtggagtgac
tggagtcccaaaagttacattaagctccaaaaagacgtcagagtgaaggatatacttgtt
tggatctttgtggcttgtttatcgtttgctgtgtgtttgatcatggtctgcactcttgct
ctgaaaagaactaacatggtggcccggattctgccacccattccacgtccgaaaattaaa
ggctttgatgctcagctattagaggcggggaaaactgaagaattgctgagtgccctggat
tgccatggtttccctccaacgtcagattatgatgacctgctggtggaatttttggaagta
gacgacagcgaagaccagcaactgatgccaagtcaagagaagaagtatcccaattccacg
caccaggatacagacagcgattcggggcgaggaagttgtgagagcccttctctattatca
gagaagcgcaaagatgccagaaatccagctgaactgaaaacactggatatcgaaggtgtg
caaaagaacgctggtataaaaagcacaccagaaacctcaaatatagactgtgaaggacag
cttccctggtccagcagtggtggaccacaggcatccacatggccagggcctcagctgcca
aactatcagactcctaattgtttcaataaggaaatcacagatgtgtgtaaaatagcactc
agtgccattaatggaaacaggtcacctgttttgatggagagtgaaaatacactccatcat
tcccaacatccgaaaaccacagaaacaattagcaaaggagcaccaaccaggttggaggat
gggacaaacttgcccttaaatgttcatggtgaccaaagggccttgtggttattccctccg
gtgaggttgccttcttcatctataaagccaatggactatgtagaagtccacaaagtcaac
catgatggagtgctggctgtttttccaaagcagaaagaaaatgctcacaaagctgagaag
agtcctgctgccagagatacaaatgaatacaccaaggtttcaacagttgcagacaaccat
attttggtgttatttcctgatcccaaaatggaggccttgccttcttttcaggaaacgcca
aaggaacccagccagatatattcacaaagccaagcagagaaaagtatgggctattgtctc
tcagctccaaatgcattcaaaatgcagagtggtggactggactacatggatccaaataat
tttatgcccacttttaattaa

DBGET integrated database retrieval system