KEGG   Anolis carolinensis (green anole): 100565189Help
Entry
100565189         CDS       T01608                                 

Gene name
prlr
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100565189 (prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100565189 (prlr)
   04060 Cytokine-cytokine receptor interaction
    100565189 (prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 826 aa AA seqDB search
MRIHTSPSKTLTMLLSLSMWLVNGQSPPGKPTIIGCQLSGNESFTCRWESDSSGGLPKNY
SLLYLTERDEQLHECPDYISAGPNSCYFDKSYTRLWTTYNITVKATNDLGSNFSDPHSVD
MRTLGKPEPPLDLSLELRQLNETLYLWAKWSPPPSITDGAASWESCNYELQTNIDGGAKW
EIYAVGKRTQYKISQLRPDVKYTVQVRCVRDSGEASEWSPESYFKLHSGQPPGKPELIRC
RSPEKETFTCWWKPGSDGGLPNNYIFFYNKEGEDEFHECPDYTTAGPNSCYFSKKHTSIW
RTYNFTIKAMNEIGSTASDSYYVDVANIVQPDPPENLSLEFEKKVYGEYLLLKWSPPLLG
DLRSGWLTLDYELRIKPEEGQVWEKIFVGHRTTYKMYSLNPGERYVAQVRCRSDHGLWSD
WSPKSYIKLQKDVRVKDILVWIFVACLSFAVCLIMVCTLALKRTNMVARILPPIPRPKIK
GFDAQLLEAGKTEELLSALDCHGFPPTSDYDDLLVEFLEVDDSEDQQLMPSQEKKYPNST
HQDTDSDSGRGSCESPSLLSEKRKDARNPAELKTLDIEGVQKNAGIKSTPETSNIDCEGQ
LPWSSSGGPQASTWPGPQLPNYQTPNCFNKEITDVCKIALSAINGNRSPVLMESENTLHH
SQHPKTTETISKGAPTRLEDGTNLPLNVHGDQRALWLFPPVRLPSSSIKPMDYVEVHKVN
HDGVLAVFPKQKENAHKAEKSPAARDTNEYTKVSTVADNHILVLFPDPKMEALPSFQETP
KEPSQIYSQSQAEKSMGYCLSAPNAFKMQSGGLDYMDPNNFMPTFN
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcatacatcaccttcaaagacacttaccatgctcctttctttgagcatgtgg
cttgtgaatggtcaatcacctcctgggaagcctacaataataggttgccaattgtcagga
aatgaatcatttacctgtcgatgggaatctgattcaagtggaggacttcctaaaaattac
tctctactgtatctcacagaaagagatgaacagctccatgaatgtccagactacatatca
gcaggccccaattcgtgttattttgataaaagctacaccaggctttggaccacatacaat
atcacagtaaaagctaccaatgatttggggagtaatttctctgatcctcactctgtggac
atgcgaaccctaggtaagccagagcctcccttggatctttctctggagctcagacagttg
aacgagacactgtatttgtgggcaaaatggtcaccgccaccttcaataactgatggtgca
gcaagctgggaaagctgcaattatgagttgcaaacaaacatcgatggaggagcaaaatgg
gagatttatgctgtcgggaagcgaacacaatataaaatatctcagttgcgtccagatgtg
aaatatacagttcaggttcgctgtgtaagagatagcggggaggctagtgaatggagtcca
gaaagctacttcaaactccacagtggccaacctccagggaagccagagttaataagatgc
cgctctcccgaaaaagaaacctttacttgctggtggaaacctggttctgacggaggtctc
cctaataactacattttcttctataacaaggaaggagaggatgagttccacgaatgtcca
gactacacaactgcaggacccaattcttgttatttcagtaaaaagcatacttctatttgg
aggacatacaattttaccataaaggctatgaatgagataggaagtactgcctctgactct
tattatgtggatgtggctaacatagttcagccagatcctccagaaaacctgtctctggaa
tttgagaaaaaagtgtatggggagtatctcttgttgaaatggtctccaccgttgctgggt
gatctcagatccggctggctcacccttgactatgagttgcgcataaaaccagaagaaggg
caagtgtgggagaaaatatttgttggacatagaacaacttacaagatgtacagtttaaat
ccaggagaaagatatgttgcccaagtccgctgcaggtctgaccatggcttgtggagtgac
tggagtcccaaaagttacattaagctccaaaaagacgtcagagtgaaggatatacttgtt
tggatctttgtggcttgtttatcgtttgctgtgtgtttgatcatggtctgcactcttgct
ctgaaaagaactaacatggtggcccggattctgccacccattccacgtccgaaaattaaa
ggctttgatgctcagctattagaggcggggaaaactgaagaattgctgagtgccctggat
tgccatggtttccctccaacgtcagattatgatgacctgctggtggaatttttggaagta
gacgacagcgaagaccagcaactgatgccaagtcaagagaagaagtatcccaattccacg
caccaggatacagacagcgattcggggcgaggaagttgtgagagcccttctctattatca
gagaagcgcaaagatgccagaaatccagctgaactgaaaacactggatatcgaaggtgtg
caaaagaacgctggtataaaaagcacaccagaaacctcaaatatagactgtgaaggacag
cttccctggtccagcagtggtggaccacaggcatccacatggccagggcctcagctgcca
aactatcagactcctaattgtttcaataaggaaatcacagatgtgtgtaaaatagcactc
agtgccattaatggaaacaggtcacctgttttgatggagagtgaaaatacactccatcat
tcccaacatccgaaaaccacagaaacaattagcaaaggagcaccaaccaggttggaggat
gggacaaacttgcccttaaatgttcatggtgaccaaagggccttgtggttattccctccg
gtgaggttgccttcttcatctataaagccaatggactatgtagaagtccacaaagtcaac
catgatggagtgctggctgtttttccaaagcagaaagaaaatgctcacaaagctgagaag
agtcctgctgccagagatacaaatgaatacaccaaggtttcaacagttgcagacaaccat
attttggtgttatttcctgatcccaaaatggaggccttgccttcttttcaggaaacgcca
aaggaacccagccagatatattcacaaagccaagcagagaaaagtatgggctattgtctc
tcagctccaaatgcattcaaaatgcagagtggtggactggactacatggatccaaataat
tttatgcccacttttaattaa

DBGET integrated database retrieval system