KEGG   Anolis carolinensis (green anole): 100565397Help
Entry
100565397         CDS       T01608                                 

Gene name
cyp19a1
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:acs00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 453 aa AA seqDB search
MVMEALNPMHYNITRAVSETMPTATLPLLFFMGFIFLIWTYEETSTIPVLTKNEYALSSS
MFHIMKHGHYISRFGSKPGLKCIGMHENGIIFNNNPALWKEIRPFFTKALSGPGLVRMIA
ICVESTIEHMDKLEEVTTKCGYVNSLNLMRRVMLDTSNRLFLGIPLDEDAIVLKIQNYFD
AWQALLLKPDIFFKFSWLYKKYEKSANDLKEAIEDLIEQKRQKLSTIDKLEDHMDFASQL
IFAQSRGELTAENVNQCVLEMLIAAPDTLSVTLFFILYDIVTSDLSSLILEGDRDIQSED
MPKLKVVENFILESMRYQPVVDLVMRKALQDDVIDGYPVKKGTNIILNIGRMHRLEFFPK
PNEFSLENFEKSVPYRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRIQTEKGEGLN
DIPKNNDLSLHPNERQPLLEMLFTPRSNEGKKE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggaagccctgaatcccatgcactacaacatcacccgtgccgtctcggagacg
atgccaacggccaccctacccctgctgttcttcatgggcttcattttcctaatctggacc
tatgaagaaacatcaacgatcccagttttaaccaaaaatgaatatgctttatcgtcaagc
atgttccacatcatgaagcacggacactacatctcaaggttcgggagcaagcctggtcta
aagtgcatcggcatgcacgaaaacggcatcatatttaataataaccctgcgctctggaaa
gaaatccgaccctttttcaccaaagctctgtcgggcccaggtcttgtgcggatgatcgcc
atttgcgtggaatccaccatcgaacacatggacaagctggaagaagtgaccaccaagtgt
ggctacgtcaatagcctgaaccttatgaggcgggttatgctggacacttcaaacaggctt
ttccttggcattcctctggatgaagacgccattgtacttaagatccagaattactttgat
gcctggcaggcacttctgctgaaacccgatatcttctttaagttttcttggctgtacaag
aaatacgaaaagtccgcgaacgatctgaaagaagccatcgaggacctaatagagcagaag
cggcaaaagctttccacgattgacaaactggaggaccatatggattttgcatcccagttg
atttttgcgcagagccgcggggagctgactgctgagaacgtcaaccagtgcgttttggag
atgctcatcgctgccccggacaccctttcggtcactctgttcttcatactatatgacata
gtgaccagcgatttgtcttccttgattcttgaaggtgacagagacatccaaagcgaggac
atgccgaagctgaaggtggttgagaatttcattctggagagcatgagataccagccggtc
gtggacttggtcatgcgcaaagctctgcaagatgatgtgattgatggctatccggtgaaa
aaaggcaccaacatcattctcaacatcgggcgcatgcatcggcttgagttcttcccaaag
cccaatgagttctcgctcgaaaattttgaaaagagtgtcccttaccgctatttccagccc
tttggcttcggcccgcgtggctgcgttgggaagttcatcgccatggtcatgatgaaggcc
atcctggtgactctcctgagaaggtgccgcatccagactgagaagggcgaagggctgaac
gacatccccaaaaacaatgacttgtcgttgcatcccaatgaaaggcagccgttgctggag
atgctattcacaccgagaagtaatgagggcaagaaggaataa

DBGET integrated database retrieval system