KEGG   Anolis carolinensis (green anole): 100565397Help
Entry
100565397         CDS       T01608                                 

Gene name
cyp19a1
Definition
(RefSeq) cytochrome P450, family 19, subfamily A, polypeptide 1
  KO
K07434  
aromatase [EC:1.14.14.14]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100565397 (cyp19a1)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100565397 (cyp19a1)
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP19 family
   100565397 (cyp19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 423 aa AA seqDB search
MYGEFMRVWINGEETLIISKSSSMFHIMKHGHYISRFGSKPGLKCIGMHENGIIFNNNPA
LWKEIRPFFTKALSGPGLVRMIAICVESTIEHMDKLEEVTTKCGYVNSLNLMRRVMLDTS
NRLFLGIPLDEDAIVLKIQNYFDAWQALLLKPDIFFKFSWLYKKYEKSANDLKEAIEDLI
EQKRQKLSTIDKLEDHMDFASQLIFAQSRGELTAENVNQCVLEMLIAAPDTLSVTLFFML
VLIAEHPQVEEAMMKEIQTVISDRDIQSEDMPKLKVVENFILESMRYQPVVDLVMRKALQ
DDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFSLENFEKSVPYRYFQPFGFGPRGCVG
KFIAMVMMKAILVTLLRRCRIQTEKGEGLNDIPKNNDLSLHPNERQPLLEMLFTPRSNEG
KKE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcgaattcatgagagtctggatcaacggagaagagaccctcattattagcaaa
tcgtcaagcatgttccacatcatgaagcacggacactacatctcaaggttcgggagcaag
cctggtctaaagtgcatcggcatgcacgaaaacggcatcatatttaataataaccctgcg
ctctggaaagaaatccgaccctttttcaccaaagctctgtcgggcccaggtcttgtgcgg
atgatcgccatttgcgtggaatccaccatcgaacacatggacaagctggaagaagtgacc
accaagtgtggctacgtcaatagcctgaaccttatgaggcgggttatgctggacacttca
aacaggcttttccttggcattcctctggatgaagacgccattgtacttaagatccagaat
tactttgatgcctggcaggcacttctgctgaaacccgatatcttctttaagttttcttgg
ctgtacaagaaatacgaaaagtccgcgaacgatctgaaagaagccatcgaggacctaata
gagcagaagcggcaaaagctttccacgattgacaaactggaggaccatatggattttgca
tcccagttgatttttgcgcagagccgcggggagctgactgctgagaacgtcaaccagtgc
gttttggagatgctcatcgctgccccggacaccctttcggtcactctgttcttcatgctg
gtgctgatcgcagagcacccccaagtcgaagaggccatgatgaaggaaatacagaccgtg
ataagtgacagagacatccaaagcgaggacatgccgaagctgaaggtggttgagaatttc
attctggagagcatgagataccagccggtcgtggacttggtcatgcgcaaagctctgcaa
gatgatgtgattgatggctatccggtgaaaaaaggcaccaacatcattctcaacatcggg
cgcatgcatcggcttgagttcttcccaaagcccaatgagttctcgctcgaaaattttgaa
aagagtgtcccttaccgctatttccagccctttggcttcggcccgcgtggctgcgttggg
aagttcatcgccatggtcatgatgaaggccatcctggtgactctcctgagaaggtgccgc
atccagactgagaagggcgaagggctgaacgacatccccaaaaacaatgacttgtcgttg
catcccaatgaaaggcagccgttgctggagatgctattcacaccgagaagtaatgagggc
aagaaggaataa

DBGET integrated database retrieval system