KEGG   Anolis carolinensis (green anole): 100565447Help
Entry
100565447         CDS       T01608                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 501 aa AA seqDB search
MDLARLWHLAAAFCLTWLLLKALQLHRRRKELLKSLSSFPGPPAHWLYGNMFELLPYSVV
FKKTEQWMLLYPYAFPLWFGRYFASVTITHPDYAKTLLARADPKDRLTYPSMIPWIGKGL
LVLDGPKWAQHRKLLTPGFHYNILKPYVTLMAESTKVMLDKWEQLIIQQNSVELFEHVSL
MTLEIIMKCAFSYNTNCQLDRENSYVKAVFELCSLVFEKLFSIFGHHDVTYWFTPQAYRF
RKACKVAHRHTEKIIKERKESLGDEEELQKIQQKRYLDFLDIILCAKDENGIGLSDEDIR
AEVDTFMFAGHDTTASGISWMLYCLAMNPEHQGRCREEIKSILGDRGTIEWDDLSKMTYC
TLCIKESLRLYPPVPGVSREIAKPITFFDGKILPEGTMIGVAIQLIHRNPNIWIDPEVFD
PQRFTPENVSSRNSHAFLPFSAGPRNCIGQQFAMNEMKIALAMTLLRFEISPDALKPPPV
PIPQIVLRSQNGIHLCLKKIM
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacctggcccggctttggcacttggctgccgccttttgcctgacctggctgctgctc
aaagctctgcagctccaccgacgacggaaggagctcctgaaaagcctgagcagcttcccc
gggccccccgcccactggctgtacggtaatatgtttgagcttttaccctattccgtagtg
ttcaagaagacagaacaatggatgcttctgtatccatacgcctttccattgtggtttggg
aggtactttgcaagtgtaacaatcactcatcctgactatgcaaaaacattacttgctaga
gcagatccgaaggacaggctaacttatccaagcatgatcccatggattggaaaaggcttg
ctggtcttagacggaccaaagtgggcacagcatcgaaaactgcttactccaggtttccac
tataacattttgaagccctatgtgacactaatggcagagtctaccaaagtgatgttggat
aaatgggaacagttgatcatacagcagaactcagtagagctctttgaacatgtgagtttg
atgacgcttgaaattatcatgaaatgtgccttcagttataacaccaattgtcaactggac
agggagaactcctatgtcaaagcggtctttgaactttgctccttggtatttgagaaatta
ttctccatctttggccaccatgatgtgacatactggtttactccgcaggcatatcggttt
cggaaagcttgcaaggtcgctcatcgtcatacagaaaaaatcattaaagagagaaaggaa
tcactgggggatgaagaagaactccaaaagatccagcagaaaagatacttggattttttg
gacatcattctctgtgccaaagatgaaaatggcattggactatctgatgaagatatacgt
gcagaagtggatactttcatgtttgcaggtcatgataccacagcaagtggcatttcctgg
atgctttattgtcttgcaatgaacccagaacatcaggggagatgtagggaggagatcaag
tccattctgggagaccgtggcaccattgaatgggatgatcttagcaagatgacctattgc
accctgtgcattaaagagagcctccgcctttatcctccagtaccaggagtgtcccgagag
attgccaaacctattacattttttgatggaaagatcttgcctgaaggaactatgattgga
gtagctattcaactcatccacaggaaccccaacatatggatagatccagaggtatttgat
ccccagaggtttacacctgagaatgtttctagcagaaattcccatgccttcctgccattc
tctgctggaccaaggaactgtattgggcagcagtttgccatgaatgaaatgaaaatagct
cttgccatgactttgcttcggtttgaaatttcacctgatgctttgaagcccccacctgtt
cctatccctcagattgtcttgcgttcccagaatgggatacacctttgtttgaaaaaaatt
atgtga

DBGET integrated database retrieval system