KEGG   Anolis carolinensis (green anole): 100565447Help
Entry
100565447         CDS       T01608                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100565447
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP4 family
   100565447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 501 aa AA seqDB search
MDLARLWHLAAAFCLTWLLLKALQLHRRRKELLKSLSSFPGPPAHWLYGNMFELLPYSVV
FKKTEQWMLLYPYAFPLWFGRYFASVTITHPDYAKTLLARADPKDRLTYPSMIPWIGKGL
LVLDGPKWAQHRKLLTPGFHYNILKPYVTLMAESTKVMLDKWEQLIIQQNSVELFEHVSL
MTLEIIMKCAFSYNTNCQLDRENSYVKAVFELCSLVFEKLFSIFGHHDVTYWFTPQAYRF
RKACKVAHRHTEKIIKERKESLGDEEELQKIQQKRYLDFLDIILCAKDENGIGLSDEDIR
AEVDTFMFAGHDTTASGISWMLYCLAMNPEHQGRCREEIKSILGDRGTIEWDDLSKMTYC
TLCIKESLRLYPPVPGVSREIAKPITFFDGKILPEGTMIGVAIQLIHRNPNIWIDPEVFD
PQRFTPENVSSRNSHAFLPFSAGPRNCIGQQFAMNEMKIALAMTLLRFEISPDALKPPPV
PIPQIVLRSQNGIHLCLKKIM
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacctggcccggctttggcacttggctgccgccttttgcctgacctggctgctgctc
aaagctctgcagctccaccgacgacggaaggagctcctgaaaagcctgagcagcttcccc
gggccccccgcccactggctgtacggtaatatgtttgagcttttaccctattccgtagtg
ttcaagaagacagaacaatggatgcttctgtatccatacgcctttccattgtggtttggg
aggtactttgcaagtgtaacaatcactcatcctgactatgcaaaaacattacttgctaga
gcagatccgaaggacaggctaacttatccaagcatgatcccatggattggaaaaggcttg
ctggtcttagacggaccaaagtgggcacagcatcgaaaactgcttactccaggtttccac
tataacattttgaagccctatgtgacactaatggcagagtctaccaaagtgatgttggat
aaatgggaacagttgatcatacagcagaactcagtagagctctttgaacatgtgagtttg
atgacgcttgaaattatcatgaaatgtgccttcagttataacaccaattgtcaactggac
agggagaactcctatgtcaaagcggtctttgaactttgctccttggtatttgagaaatta
ttctccatctttggccaccatgatgtgacatactggtttactccgcaggcatatcggttt
cggaaagcttgcaaggtcgctcatcgtcatacagaaaaaatcattaaagagagaaaggaa
tcactgggggatgaagaagaactccaaaagatccagcagaaaagatacttggattttttg
gacatcattctctgtgccaaagatgaaaatggcattggactatctgatgaagatatacgt
gcagaagtggatactttcatgtttgcaggtcatgataccacagcaagtggcatttcctgg
atgctttattgtcttgcaatgaacccagaacatcaggggagatgtagggaggagatcaag
tccattctgggagaccgtggcaccattgaatgggatgatcttagcaagatgacctattgc
accctgtgcattaaagagagcctccgcctttatcctccagtaccaggagtgtcccgagag
attgccaaacctattacattttttgatggaaagatcttgcctgaaggaactatgattgga
gtagctattcaactcatccacaggaaccccaacatatggatagatccagaggtatttgat
ccccagaggtttacacctgagaatgtttctagcagaaattcccatgccttcctgccattc
tctgctggaccaaggaactgtattgggcagcagtttgccatgaatgaaatgaaaatagct
cttgccatgactttgcttcggtttgaaatttcacctgatgctttgaagcccccacctgtt
cctatccctcagattgtcttgcgttcccagaatgggatacacctttgtttgaaaaaaatt
atgtga

DBGET integrated database retrieval system