KEGG   Anolis carolinensis (green anole): 100565456Help
Entry
100565456         CDS       T01608                                 

Gene name
usp5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100565456 (usp5)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100565456 (usp5)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100565456 (usp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 855 aa AA seqDB search
MAELNEALLSVLPSIRVPKAGDRVHKDECAFSFDTPESDGGLYICMNTFLGFGRQYVTKH
YEKTGQRVYLHLKKTRKLKEEDTNSSAGDPPRKKPTRLAIGVEGGFDIPEEKYEYDEHVK
IVILPEHLDIPRDGLDSLPDMVKDRISSAIEAILTADSASRKQEVQAWDGEVRRVSRHAF
SLQQLQNGVRIPPCGWKCSKCDMRENLWLNMTDGSILCGRHYFDGSGGNNHAVEHYRETG
YPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFGIDMLKMQKTDKTMTELEIDMN
QRIGEWELIQESGVQLKPLYGPGYTGIRNLGNSCYLNSVVQVIFSIPDFQQKYVDKLEKI
FQSSPADPTQDFNTQVAKLGHGLLSGEYSKPSSAEGEQQPEQKDIQDGIAPRMFKSLVGK
GHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKLKCLATEKVKYTQRV
DYIMQLPVPMEAALNKDELLEYEEKKRQAEEEKQPLPELVRAKVPFSSCLEAYGAPEQVD
DFWSTALQAKSVALKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPDELDISALQ
GTGLQADEEEMPDIAPPLVTPDEPKGSLGFYGNEDDDSFCSPHFSSPTSPMLDESVITQL
VEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTITCPDPP
SEDSVATIVSMGFSRDQAMKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAAES
IPESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKDSRWVIYNDQKVCASEKP
PKDLGYIYFYQRTIS
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgaacgaagcgttactctctgtgctgccctccatccgggtgcccaaggcc
ggggaccgcgtccataaggatgagtgcgccttctccttcgataccccggagtctgatggg
ggtttgtatatttgcatgaacacattcctgggctttggaaggcaatatgtgacgaaacat
tatgagaagacaggccagagggtctacctacatcttaagaagactcgcaaattgaaagaa
gaagacaccaactccagtgctggagatcctccaaggaagaaaccaacccgtctagcaatt
ggtgtggaaggtgggtttgacatcccagaggagaaatatgaatatgatgaacatgtcaaa
atagttattttaccagagcacttggatattcctcgggatggactggacagtctgccagac
atggtcaaagacaggatttctagtgcaattgaagctattctaactgcagactctgcatca
cggaagcaggaagtgcaagcttgggatggggaggttcggcgtgtgtctagacatgccttc
tcactccagcagctccaaaatggtgtgcgtatccctccttgtggctggaaatgcagcaag
tgtgatatgcgagagaacctgtggctcaacatgacagatgggtccatcctgtgtggacgg
cactacttcgatggcagtgggggcaacaatcatgctgtggagcattatcgggagactggc
tacccattggctgtgaagttgggaactatcactcctgacggggctgacgtctactcttac
gatgaggatgacatggttttggaccccaacctggctgagcacttggctcattttgggatt
gacatgctcaaaatgcagaagactgacaaaacgatgacagagctagagattgatatgaac
caacggattggcgagtgggaactgatccaggagtctggggtgcagctcaagcctctctat
ggccctggatatacagggatccgtaacctgggaaacagctgctacctcaattcagtagtg
caggtgatcttcagcataccagactttcagcagaagtatgtagacaagctagagaaaatt
ttccagagttcccctgcagaccctacacaagacttcaacacccaagtagccaagttgggc
catgggctactatctggagaatattcaaaaccttcttctgcagaaggagaacagcagcct
gagcagaaggacattcaagatggcattgcaccacgcatgtttaaatctcttgttggtaaa
gggcatccggaattttctaccaatcgacagcaagatgctcaggagtttttcctgcacttt
ataaacatggtggagaggaattgccgtagctctgaaaatccaaatgaggtcttccgtttc
ttagttgaggagaagctcaagtgcttagctactgagaaggtgaaatacactcaacgtgtc
gattatatcatgcagctgccagtgcccatggaagcagcattgaacaaagatgagttgctg
gaatatgaagaaaagaaaaggcaggcagaggaggagaagcagcccttgcctgagttggtc
cgtgccaaggtgcctttcagctcctgtcttgaggcctatggagctccagaacaagtagat
gacttctggagcacagccttgcaggccaagtctgtggcactcaagacaacccggtttgcc
tcctttccagattatctagtgatccagatcaagaaattcacttttggcctagactgggta
cctaaaaagctagatgtctccattgaaatgccggacgagttggacatctctgcacttcag
gggacaggactacaggccgacgaagaggagatgccagatatcgcgcccccgctagtgacc
ccagatgaacccaaaggtagcctgggtttctatggcaacgaggacgacgactccttctgc
tcccctcacttctcctctccaacatcccccatgctggatgagtctgtgattacccaacta
gtggagatgggctttccaatggatgcttgccgcaaagccgtgtattacactgggaacagt
ggggctgaggcggcaatgaactgggtcatgtcacacatggatgatccagattttgcaaat
cctctggttcttccgggatccagtggaccaggttccactatcacctgtccagatccccca
tccgaagatagtgtagcaaccatcgtctccatgggcttctcccgggatcaggctatgaaa
gcactaagagcgacaaacaacagtcttgagcgagctgtggactggatcttcagccacatt
gatgatctggatgcagaagctgccatggatatctctgagggacgttcagcagcagaatca
atccctgaatctgtccctgtagggccaaaagtgcgtgacggacctggaaaataccaactc
tttgccttcatcagccacatgggtacatccactatgtgcggccattacgtttgtcatatc
aagaaggatagtaggtgggtgatctataatgaccagaaagtctgcgcctccgagaagcct
ccaaaggatcttggttacatctacttttaccagaggaccatcagttag

DBGET integrated database retrieval system