KEGG   Anolis carolinensis (green anole): 100565465Help
Entry
100565465         CDS       T01608                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 573 aa AA seqDB search
MGSASSKDDSAPVKTPEASVPFSLTDVFLFSIIIGLLTYWFFFRKKKEEVPDFAKIQTPS
AAQSTNDSSFIEKMKKDGKNIVVFYGSQTGTAEEFANRLAKDAHRYGMRGMSADPEEYNL
SDLNRLPEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQETDADLSGLKFAVFGLGNKTYE
HFNAMGKYVDKRMEELGAQRIFELGLGDDDGKRTGSFLPRGWCRLQPFLEPPEQTGFSAN
GMSSVAHGKESNKKHPFPCPTTYRTALTHYLDITNPPRTNVLYELAQYASAASEQEHLRK
MASSSAEGKALYLSWVVEARRNILAILQDTPSLRPPIDHLCELLPRLQARYYSIASSSKV
HSNSIHICAVVVEYTTKTGRVNKGVATNWLKSKQPMDNGHKSVVPMYVRKSQFRLPFKSS
TPVLMIGPGTGVAPFIGFIQERGLHKKQGKEVGETVLYYGCRHENEDYLYKEELANFLKE
GALTQLHVAFSRDQAQKVYVQHLLKKNKESVWKLIHEDNGHIYVCGDARNMARDVQNTFY
EIVAEFGKMDQPQAVDYIKKLMTKGRYSLDIWS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggggtcagcttcgtccaaggatgactccgctccagtcaagacccccgaggcctcagtc
cccttcagcctcaccgacgtcttcctcttctccatcatcatcggactcttgacctactgg
tttttcttccgcaagaagaaagaagaggtccctgactttgccaagatccagacgccatcc
gcagcacagtcgacgaatgacagcagcttcattgaaaaaatgaaaaaagacggtaaaaac
attgtcgtcttctatggctcccagacggggacggccgaggagttcgccaaccgccttgcc
aaggacgcccatcgctatgggatgcggggcatgtctgccgacccggaggagtacaacttg
tctgacctgaaccgcctccccgagatcgacaaatccctggcggtcttctgcatggccacc
tacggcgagggagaccccacggacaacgcccaggacttctacgactggctgcaggagacg
gacgccgatctgtccggcctcaagtttgcggtctttgggctcgggaacaagacttacgaa
cacttcaacgccatggggaaatatgtggacaagcggatggaggaactgggagcccagcgc
atcttcgaactcggcttgggtgatgacgacgggaaacgaactggttctttcctcccacgg
ggttggtgccgacttcaaccttttctggaacctcccgagcaaaccggtttctctgcaaac
ggcatgtcgtctgtggcccatggcaaggagtccaacaagaagcaccccttcccatgcccg
accacctaccggacggcgctgactcactacctggacatcaccaacccgccacgcaccaac
gtcctctacgagctggcccagtatgcctccgcggccagtgagcaggagcacctgcgcaag
atggcctcctcctccgccgaaggcaaggccttgtaccttagctgggtggtggaggcccgg
aggaacatcctggccatcttgcaagacacaccatccctgcgaccgcctattgaccacctc
tgcgagctccttccccgcctccaggcgcgctactactctatcgcctcttcctccaaggtg
cattcgaactccatccacatctgtgcggtggtggtggagtacaccaccaagacggggcgg
gtgaacaaaggagtggccacgaattggctcaagagcaagcagcccatggacaacgggcac
aagtccgtggtgcccatgtacgtccgcaagtcccagttccggctgcccttcaagtccagc
acgcctgttctcatgatcgggcccggcaccggcgtggctccctttataggcttcatccag
gagcggggattgcacaagaagcaaggcaaagaagtgggcgagacagtgctctactatggc
tgccggcacgagaatgaggactacctctacaaggaggaactggccaacttcctcaaggaa
ggagccctcacgcagctccacgtggccttctcccgggatcaggcccagaaggtttacgtc
cagcaccttctgaagaagaacaaggagagtgtctggaagctgatccacgaagacaacggc
cacatctacgtctgcggagacgcccgcaacatggcccgcgacgtgcagaacaccttctac
gagatcgtggccgagttcggcaagatggaccagccgcaggcggtggactacatcaagaag
ctcatgaccaagggccgctactccttggacatctggagttaa

DBGET integrated database retrieval system