KEGG   Anolis carolinensis (green anole): 100565465Help
Entry
100565465         CDS       T01608                                 

Gene name
por
Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100565465 (por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100565465
NCBI-ProteinID: XP_008120878
Position
Un
AA seq 678 aa AA seqDB search
MGSASSKDDSAPVKTPEASVPFSLTDVFLFSIIIGLLTYWFFFRKKKEEVPDFAKIQTPS
AAQSTNDSSFIEKMKKDGKNIVVFYGSQTGTAEEFANRLAKDAHRYGMRGMSADPEEYNL
SDLNRLPEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQETDADLSGLKFAVFGLGNKTYE
HFNAMGKYVDKRMEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGDE
SSIRQYELVVHTDINANKVYTGEMGRLKSFENQKPPFDAKNPFLAPVLVNRKLNQGGERH
LMHLEVDITGSKIRYESGDHVAVYPCNDTSLVNQLGEILGADLDTVISLNNLDEESNKKH
PFPCPTTYRTALTHYLDITNPPRTNVLYELAQYASAASEQEHLRKMASSSAEGKALYLSW
VVEARRNILAILQDTPSLRPPIDHLCELLPRLQARYYSIASSSKVHSNSIHICAVVVEYT
TKTGRVNKGVATNWLKSKQPMDNGHKSVVPMYVRKSQFRLPFKSSTPVLMIGPGTGVAPF
IGFIQERGLHKKQGKEVGETVLYYGCRHENEDYLYKEELANFLKEGALTQLHVAFSRDQA
QKVYVQHLLKKNKESVWKLIHEDNGHIYVCGDARNMARDVQNTFYEIVAEFGKMDQPQAV
DYIKKLMTKGRYSLDIWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggggtcagcttcgtccaaggatgactccgctccagtcaagacccccgaggcctcagtc
cccttcagcctcaccgacgtcttcctcttctccatcatcatcggactcttgacctactgg
tttttcttccgcaagaagaaagaagaggtccctgactttgccaagatccagacgccatcc
gcagcacagtcgacgaatgacagcagcttcattgaaaaaatgaaaaaagacggtaaaaac
attgtcgtcttctatggctcccagacggggacggccgaggagttcgccaaccgccttgcc
aaggacgcccatcgctatgggatgcggggcatgtctgccgacccggaggagtacaacttg
tctgacctgaaccgcctccccgagatcgacaaatccctggcggtcttctgcatggccacc
tacggcgagggagaccccacggacaacgcccaggacttctacgactggctgcaggagacg
gacgccgatctgtccggcctcaagtttgcggtctttgggctcgggaacaagacttacgaa
cacttcaacgccatggggaaatatgtggacaagcggatggaggaactgggagcccagcgc
atcttcgaactcggcttgggtgatgacgacgggaacctggaggaagacttcatcacgtgg
cgggagcagttctggccggccgtctgtgaacactttggcgtggaggcgacaggagatgaa
tccagcatacgccagtatgagctggtcgtccacacggacatcaacgcaaacaaggtttac
accggcgagatgggtcggctgaagagtttcgagaaccagaaaccgccgtttgatgccaag
aaccccttcttggctcctgtgttggtgaaccggaagctgaaccaaggtggggagcggcac
ctcatgcacctcgaggtggacatcaccgggtctaagatcagatatgagtctggagaccac
gtggccgtctatccctgcaatgacacttcgctggtgaaccagttgggagagatcctggga
gccgatttggatacggtcatttccctaaacaacctggatgaggagtccaacaagaagcac
cccttcccatgcccgaccacctaccggacggcgctgactcactacctggacatcaccaac
ccgccacgcaccaacgtcctctacgagctggcccagtatgcctccgcggccagtgagcag
gagcacctgcgcaagatggcctcctcctccgccgaaggcaaggccttgtaccttagctgg
gtggtggaggcccggaggaacatcctggccatcttgcaagacacaccatccctgcgaccg
cctattgaccacctctgcgagctccttccccgcctccaggcgcgctactactctatcgcc
tcttcctccaaggtgcattcgaactccatccacatctgtgcggtggtggtggagtacacc
accaagacggggcgggtgaacaaaggagtggccacgaattggctcaagagcaagcagccc
atggacaacgggcacaagtccgtggtgcccatgtacgtccgcaagtcccagttccggctg
cccttcaagtccagcacgcctgttctcatgatcgggcccggcaccggcgtggctcccttt
ataggcttcatccaggagcggggattgcacaagaagcaaggcaaagaagtgggcgagaca
gtgctctactatggctgccggcacgagaatgaggactacctctacaaggaggaactggcc
aacttcctcaaggaaggagccctcacgcagctccacgtggccttctcccgggatcaggcc
cagaaggtttacgtccagcaccttctgaagaagaacaaggagagtgtctggaagctgatc
cacgaagacaacggccacatctacgtctgcggagacgcccgcaacatggcccgcgacgtg
cagaacaccttctacgagatcgtggccgagttcggcaagatggaccagccgcaggcggtg
gactacatcaagaagctcatgaccaagggccgctactccttggacatctggagttaa

DBGET integrated database retrieval system