KEGG   Anolis carolinensis (green anole): 100565611Help
Entry
100565611         CDS       T01608                                 

Definition
muscarinic acetylcholine receptor M1-like
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
acs  Anolis carolinensis (green anole)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100565611
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100565611
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100565611
G protein-coupled receptors [BR:acs04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [Table]
    100565611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 496 aa AA seqDB search
MPHGEKMNLSVFPPSPNLTQEPTTSSSGGGYSSWEVALIVFITGVLSLVTVVGNLLVMIS
FKVNRELKTVNNYFLLSLAAADLIIGTISMNLYTTYIVMGQWMMGSLACDLWLALDYVAS
NASVMSLLLISFDRYFSITRPLTYRAKRTPRRAAVMISMAWLISFVLWAPAILFWQKVVG
ERTVADHECYIQFFSEPIITFGTAIAAFYLPVTIMVVLYWRIYQETQKRAKELCGLQGSE
FSKSLAVASRTTRSGGSGSSSSSEPPQPLAPPPTSGERPLQRCCFAGPKTEEVFLDQSSN
GSWNTTEDEDAGEASADSLTSSEGEQQPFELHNVCSAVIRLPMIGTIVQTSKETQHKEPK
TATGTVLVVIPKPPLGLDKRLKNVVLMEKNQGRKRRRRRKRRSLSKRRTLSLMKEKKAAR
TLSAILLAFLITWTPYNIMVLVSTFCEGCVPQSLWELGYWLCYVNSTVNPMCYALCNRSF
RTTFRRLLLCRGVQRP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatggtgagaagatgaacctctccgtcttcccaccgtctcccaatctcacccag
gaaccgaccacgtcttcctcgggcggtggctactcctcgtgggaggtggcactgatcgtg
ttcatcaccggggtcctctccttggtcaccgtggtggggaaccttctggtgatgatctcc
ttcaaggtcaaccgggagctgaagaccgtcaacaactacttcttgctcagcttggccgcc
gccgacctcatcatcggcaccatctccatgaacctgtacacgacctacatcgtcatgggc
cagtggatgatgggctccttggcctgcgacctgtggttggccctggactacgtggccagc
aacgcctccgtcatgagcctcttgctcatcagctttgaccgctacttctccatcacgcgg
cccctcacctacagggccaagcggacccccaggcgggcggcggtgatgatcagcatggct
tggttgatctccttcgtcctgtgggccccggccatcttgttctggcagaaggtcgtcggg
gagcggacggtggccgaccacgagtgctacatccagttcttctcagagcccatcatcacg
ttcgggacggccattgccgccttctaccttccggtcaccatcatggtggtgctctactgg
aggatctaccaagagacacagaagcgggccaaggagctgtgtggactccaaggctcagag
ttcagtaagagcttagcggtggcctccagaaccaccaggagtggaggaagcggaagtagc
agcagctcggagcctcctcaacctctcgctcctcctccaacatctggagaacgtcctctg
caacggtgctgctttgcggggccaaaaacggaggaggtcttcttggaccagagtagcaac
gggagctggaacaccaccgaggacgaagacgccggagaggcctccgccgactccttgacg
tcgtccgaaggcgagcagcagcccttcgagctccacaacgtctgctccgccgtcattcgt
cttcccatgatcggcaccatcgtgcagacctccaaggagacgcagcacaaggagcccaag
acggcaactggaacggtcttggtcgtgatcccgaaaccaccgctgggcctggacaagaga
ctcaagaacgtggttttaatggagaagaaccaagggaggaagaggaggaggaggaggaag
aggaggagcctctccaagcggagaaccctctcgctgatgaaggagaagaaagcggcccgg
accctcagcgccatcctcttggccttcttgatcacgtggacaccctacaacatcatggtg
ctggtctccaccttctgcgagggctgtgtccctcagagcctctgggagctgggctactgg
ctctgctacgtcaacagcaccgtcaaccccatgtgctatgcgctgtgcaacaggtccttc
cgcaccacgttccggaggctacttctgtgtcgtggggtccagcgcccataa

DBGET integrated database retrieval system