KEGG   Anolis carolinensis (green anole): 100565632Help
Entry
100565632         CDS       T01608                                 

Gene name
agl
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:acs00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1532 aa AA seqDB search
MPQGKQTRVLLLNDMEKLDKTLFRLEQGFELQFRLGPTLQGKHVNVYCNYPTAGEVFDRH
KFKCLSWHNPTGKEDDSDKHCKLDLQISGSYQYYFSHENQKSGGGYIVVDPILRVGADNH
ELPLDCVTLQTFLAKCLGPFDGWEDRLKVAKESGYNMVHLTPVQKLGLSRSCYSLADQLE
VNPDFSTPNRKCSWNEIGKMVEKMKNEWNMLCITDVVYNHTASNSEWITQHPECAYNLVN
SPHLKPSWLLDRALWHLTCRVAGGKYSDRGLPALIEKDNHLNSLRKVIWEEIFPSLRLWE
FFQVDVNKAVQQFRTLLTQEMMRVVKTDPKQHLAVIQDPEFKRLGCTVDMNVALNTFIPH
SNGPTAIEECCNWFRKRVEELNGEMYRQTNYHQEQAVNCIMGTVSYERLAGHGPKLGAVT
RKYPLVTSYFTYPFKELSLEEEEVMMHQPDKASYFMAHNGWVMGDDPLRNFAEPGSNVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEMTAKYFHGVRLDNCHSTPLHVAEFMM
DAARKLRPNLYVVAELFTGNEELDNIFVNKLGISSLIREAMSAYNSHEEGRLVYRFGGDP
VGSFVQPHLRPLTPAIAHALFMDITHDNECPIQHRSAYDALPTSTIVSMACCATGSTRGY
DELVPHQISVVDEERFYPKWNPAATPLTPGEVNFKTGIIAGRLAINRLHQELGARAFNQV
FVDQVDEDIVAVTRHCPNTHQSVVAVSRTAFRNPKTSFYSQEVPQMCIPGKIEEVVLEAR
TVERNAGPYKKDEHAINGLPDYTVELREHIQLTESKIIRQASVATKGPNEFVQEIEFEQL
TPGSVIIFRVSLDPKAQDAVGVLRNHLIQFSPHFKSGSLPDDGSEAILKTTFLNIASKLT
LADLNQVLYRCDSEEQEDGGGCYNIPNWTPLKYGGLQGIMSVMADIRPKNDLGHPFCGNL
RAGDWMIDYVSDRLIARSGACSEVGKWLKAMFIYLKQVPRYLIPCYFDAILVGAYTTLLD
LTWKQMSNFVQNGSTFVKHLSLGSVQMCGIGKYPSLPPLSPALQDVPYRLNEITKEREQG
CVSLAAGLPHFSSGIFRCWGRDTFIALRGLMLVTGRYLEARNIILAFGSTLRHGLIPNLL
GQGTHARFNCRDAVWWWLQCIQDYCNFVSNGTDILKCPISRMYPTDDSPPLPPGQRDHPL
YELIQEAMQRHMQGIDFRERNAGPQIDRNMRDEGFNVTAGVDMETGFVYGGNRFNCGTWM
DKMGESDRARNKGIPATPRDGSAVEIVGLCKSTVRWLLELSKKNIFPYSGVTVKRHGKEE
TVTYDAWNRKIQAHFEKLFFVSENPSDPNEKHPTLVHKRGIYKDSYGASSPWCDYQLRPN
FPIAMVVAPEMFSIERAWKALEMLEQKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNVA
RGFNYHQGPEWLWPIGYFLRAKLYFSKLIGPEIYAKTVFLVKNVLSRHYVHLERSPWKGL
PELTNENGQYCPFSCETQAWSIAVILEVLYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagggtaagcagacccgagtcctgctcctcaacgacatggaaaagctggacaag
accctcttccggctggagcaaggttttgaactacagttccgacttggtcctaccttacaa
ggcaagcatgttaatgtgtattgcaactatccaactgctggagaagtgtttgatcgacac
aagttcaaatgcctgtcttggcacaatccaacaggaaaagaagacgattctgacaaacac
tgtaaactagatctccagatctctggatcttaccagtattattttagccatgaaaatcag
aaaagcgggggaggttacatagttgtggatcctattttgcgtgttggtgctgacaatcat
gaattgcccttggattgtgttacactccagacatttttagctaagtgtctgggacccttt
gatggatgggaagatcgtcttaaagtcgctaaagaatctggctacaacatggttcacttg
accccagttcaaaaacttggtctatctagatcatgttactcattggctgatcagctggaa
gtcaatcctgatttttcaactcctaatagaaaatgttcttggaatgaaattggaaaaatg
gtagaaaaaatgaaaaatgaatggaatatgctttgtattaccgatgtagtatacaatcat
acagcttcaaacagtgaatggataactcagcatcctgagtgcgcttacaatcttgtcaat
tctcctcacttgaaaccatcctggcttttggaccgagctctttggcatttaacttgcaga
gtagcaggtggcaaatacagtgatagagggctgcctgcattgattgaaaaagacaatcac
ttgaattctcttcgtaaagtcatttgggaggaaatttttcccagcctaagattgtgggag
ttcttccaagtagacgtgaacaaggcagtccagcaatttaggactctcttaacacaagaa
atgatgagagttgtcaaaacagatcccaaacaacatcttgcagtcatccaggatcctgaa
tttaagagacttggctgtactgtggatatgaatgttgcattgaacacctttataccacac
agcaatgggcccacagcaatagaagagtgctgtaactggtttcgaaagagagtggaagag
ctaaatggcgaaatgtaccggcaaacaaattaccatcaagagcaggctgtcaactgcatc
atgggaacagtgagctatgaacgattggctggccatggacctaaacttggtgcagtaact
agaaaatatcctttagttacaagctattttacatacccctttaaagaactaagcctggag
gaggaggaagttatgatgcatcagcctgacaaagcaagttactttatggcccataatggc
tgggtgatgggggatgatcctctgagaaattttgctgagccagggtcaaatgtttatctg
aggagagagcttatctgctggggtgacagtgtcaaactacgttatgggaacaaaccagaa
gactgtccatatctttgggctcacatgaaaaaatacactgaaatgactgccaagtatttt
catggagtgcgtctggacaattgccattcaacgcctcttcatgtagctgagttcatgatg
gatgcggctagaaaactgcggcccaacttgtatgtagtagctgagctgttcacagggaat
gaggagctggacaatatctttgtgaataaactgggcattagctctttaataagagaggca
atgagtgcatacaacagtcatgaagagggaagattagtttatcgctttggaggagaccca
gttgggtcttttgttcaaccacatttgagacccttaacgcctgctattgctcatgccctg
tttatggacataacgcatgataatgaatgtccaattcagcatcgatcagcttatgatgcc
cttcccacctcaaccattgtctcaatggcctgctgtgctacaggaagcactcgaggatat
gatgagctggtaccacatcagatttctgtggttgatgaagaacgtttttacccaaaatgg
aatccagcagcaacacctttgacacctggtgaagttaacttcaaaactggaattatagca
ggaaggctggctatcaacagactgcatcaagaattaggagcaagagcttttaaccaggta
tttgtagatcaagttgatgaagatattgtggctgtgacgaggcattgtcctaacacacat
cagtctgttgtagctgtttcccgaacagctttcagaaatcccaagacgtccttctatagt
caagaggttccccagatgtgtattccagggaagattgaagaagtggtacttgaggctagg
actgttgagagaaacgctggtccttataaaaaagacgagcatgcaatcaatggattgccc
gactatacagttgagctccgagaacatattcagctcaccgaaagtaaaatcatacgacaa
gcttcagttgctacaaaaggtcctaatgaatttgtccaagagatagaatttgaacagcta
actccaggaagtgtaattatattcagagttagccttgacccaaaggcccaagatgctgta
ggcgtactccggaatcacctgatccagttcagtcctcactttaaatctggaagccttccc
gatgatggttcagaggctatactcaaaacaactttcttaaacattgcatcaaaattaacc
ttggcagacctgaaccaggtactatatcgctgtgattctgaggaacaagaggatggtgga
ggatgttacaacataccaaactggacaccccttaaatacggtggccttcaaggaataatg
tcagtgatggcagacatacgaccaaagaatgatttggggcatcctttctgtggcaacctg
cgagctggagattggatgattgactatgtgagtgatcgtttaatcgctcgttccggagcc
tgctctgaagttggaaagtggctgaaagcaatgtttatctacttgaaacaagttcctcgt
tacctcattccatgttattttgatgccatattagttggtgcatatacaacacttcttgac
ttgacttggaagcagatgtctaactttgttcagaatggctcgacgtttgttaaacatctt
tccttgggttcagtccagatgtgtggaataggaaaatacccttctctgccacccctgtcg
cctgctttacaggatgttccttatcgtctgaatgaaattacaaaggaaagagaacagggc
tgtgtttctttagcagctggtttacctcatttttcttctggaattttccgctgctgggga
agggataccttcattgcactgcgggggctgatgttagtcacaggacggtacttggaagca
agaaacatcattttagcatttggaagtaccttaagacatggcctcattcccaacttgctt
ggccaagggacccatgccaggttcaattgccgggatgctgtgtggtggtggttgcagtgc
atacaagattactgtaacttcgtttcaaatggcactgacattctcaagtgtcctatatcc
agaatgtaccctacagatgactcccctcctctgccaccaggccaaagggaccacccactc
tatgaactgatacaggaagctatgcagagacatatgcagggcatagacttccgagaaagg
aatgcaggtccgcagattgatcgaaatatgagagatgaaggatttaatgtgactgcaggt
gtggatatggaaactggctttgtatatggagggaaccgttttaattgtggtacgtggatg
gataagatgggagagagtgacagagctcgcaacaaaggtattccagcaactccaagagat
ggctctgctgtagaaattgttggcttatgcaaatcaacagttcgttggctattggagttg
tctaagaagaatatatttccttattctggagttactgtaaaaagacatgggaaagaagag
acagttacttatgatgcatggaacagaaaaatccaggcccacttcgaaaagctgttcttt
gtctccgagaatccatctgatcccaatgagaagcatcctactctggttcataagcggggt
atatataaggacagctatggagcctccagcccttggtgtgactatcagctaaggccaaat
ttccctatagcaatggttgtggcacctgaaatgttctccattgaacgtgcttggaaagca
cttgaaatgttggagcaaaagctacttggtccacttggcatgaaaactctagacccagat
gatatggtttactgtggtgtgtatgacaacgccttggacaatgacaactacaatgtggca
agaggatttaattaccatcaaggacctgaatggctttggcctattggatatttccttcgt
gccaagttatacttttccaaattaattggtccagaaatctatgcaaagactgtcttcttg
gttaaaaatgtcctttctcgccattacgtacatctggagaggtcaccttggaagggtctt
ccagaactcactaatgaaaatggtcaatattgccctttcagctgtgaaacacaggcctgg
tcaattgctgtcatccttgaggttctctatgacttgtaa

DBGET integrated database retrieval system