KEGG   Anolis carolinensis (green anole): 100565632Help
Entry
100565632         CDS       T01608                                 

Gene name
agl
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100565632 (agl)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100565632 (agl)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100565632 (agl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1531 aa AA seqDB search
MPQGKQTRVLLLNDMEKLDKTLFRLEQGFELQFRLGPTLQGKHVNVYCNYPTAGEVFDRH
KFKCLSWHNPTGKEDDSDKHCKLDLQISGSYQYYFSHENQKSGGGYIVVDPILRVGADNH
ELPLDCVTLQTFLAKCLGPFDGWEDRLKVAKESGYNMVHLTPVQKLGLSRSCYSLADQLE
VNPDFSTPNRKCSWNEIGKMVEKMKNEWNMLCITDVVYNHTASNSEWITQHPECAYNLVN
SPHLKPSWLLDRALWHLTCRVAGGKYSDRGLPALIEKDNHLNSLRKVIWEEIFPSLRLWE
FFQVDVNKAVQQFRTLLTQGGSKVKTDPKQHLAVIQDPEFKRLGCTVDMNVALNTFIPHS
NGPTAIEECCNWFRKRVEELNGEMYRQTNYHQEQAVNCIMGTVSYERLAGHGPKLGAVTR
KYPLVTSYFTYPFKELSLEEEEVMMHQPDKASYFMAHNGWVMGDDPLRNFAEPGSNVYLR
RELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEMTAKYFHGVRLDNCHSTPLHVAEFMMD
AARKLRPNLYVVAELFTGNEELDNIFVNKLGISSLIREAMSAYNSHEEGRLVYRFGGDPV
GSFVQPHLRPLTPAIAHALFMDITHDNECPIQHRSAYDALPTSTIVSMACCATGSTRGYD
ELVPHQISVVDEERFYPKWNPAATPLTPGEVNFKTGIIAGRLAINRLHQELGARAFNQVF
VDQVDEDIVAVTRHCPNTHQSVVAVSRTAFRNPKTSFYSQEVPQMCIPGKIEEVVLEART
VERNAGPYKKDEHAINGLPDYTVELREHIQLTESKIIRQASVATKGPNEFVQEIEFEQLT
PGSVIIFRVSLDPKAQDAVGVLRNHLIQFSPHFKSGSLPDDGSEAILKTTFLNIASKLTL
ADLNQVLYRCDSEEQEDGGGCYNIPNWTPLKYGGLQGIMSVMADIRPKNDLGHPFCGNLR
AGDWMIDYVSDRLIARSGACSEVGKWLKAMFIYLKQVPRYLIPCYFDAILVGAYTTLLDL
TWKQMSNFVQNGSTFVKHLSLGSVQMCGIGKYPSLPPLSPALQDVPYRLNEITKEREQGC
VSLAAGLPHFSSGIFRCWGRDTFIALRGLMLVTGRYLEARNIILAFGSTLRHGLIPNLLG
QGTHARFNCRDAVWWWLQCIQDYCNFVSNGTDILKCPISRMYPTDDSPPLPPGQRDHPLY
ELIQEAMQRHMQGIDFRERNAGPQIDRNMRDEGFNVTAGVDMETGFVYGGNRFNCGTWMD
KMGESDRARNKGIPATPRDGSAVEIVGLCKSTVRWLLELSKKNIFPYSGVTVKRHGKEET
VTYDAWNRKIQAHFEKLFFVSENPSDPNEKHPTLVHKRGIYKDSYGASSPWCDYQLRPNF
PIAMVVAPEMFSIERAWKALEMLEQKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNVAR
GFNYHQGPEWLWPIGYFLRAKLYFSKLIGPEIYAKTVFLVKNVLSRHYVHLERSPWKGLP
ELTNENGQYCPFSCETQAWSIAVILEVLYDL
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagggtaagcagacccgagtcctgctcctcaacgacatggaaaagctggacaag
accctcttccggctggagcaaggttttgaactacagttccgacttggtcctaccttacaa
ggcaagcatgttaatgtgtattgcaactatccaactgctggagaagtgtttgatcgacac
aagttcaaatgcctgtcttggcacaatccaacaggaaaagaagacgattctgacaaacac
tgtaaactagatctccagatctctggatcttaccagtattattttagccatgaaaatcag
aaaagcgggggaggttacatagttgtggatcctattttgcgtgttggtgctgacaatcat
gaattgcccttggattgtgttacactccagacatttttagctaagtgtctgggacccttt
gatggatgggaagatcgtcttaaagtcgctaaagaatctggctacaacatggttcacttg
accccagttcaaaaacttggtctatctagatcatgttactcattggctgatcagctggaa
gtcaatcctgatttttcaactcctaatagaaaatgttcttggaatgaaattggaaaaatg
gtagaaaaaatgaaaaatgaatggaatatgctttgtattaccgatgtagtatacaatcat
acagcttcaaacagtgaatggataactcagcatcctgagtgcgcttacaatcttgtcaat
tctcctcacttgaaaccatcctggcttttggaccgagctctttggcatttaacttgcaga
gtagcaggtggcaaatacagtgatagagggctgcctgcattgattgaaaaagacaatcac
ttgaattctcttcgtaaagtcatttgggaggaaatttttcccagcctaagattgtgggag
ttcttccaagtagacgtgaacaaggcagtccagcaatttaggactctcttaacacaaggt
ggctcaaaggtcaaaacagatcccaaacaacatcttgcagtcatccaggatcctgaattt
aagagacttggctgtactgtggatatgaatgttgcattgaacacctttataccacacagc
aatgggcccacagcaatagaagagtgctgtaactggtttcgaaagagagtggaagagcta
aatggcgaaatgtaccggcaaacaaattaccatcaagagcaggctgtcaactgcatcatg
ggaacagtgagctatgaacgattggctggccatggacctaaacttggtgcagtaactaga
aaatatcctttagttacaagctattttacatacccctttaaagaactaagcctggaggag
gaggaagttatgatgcatcagcctgacaaagcaagttactttatggcccataatggctgg
gtgatgggggatgatcctctgagaaattttgctgagccagggtcaaatgtttatctgagg
agagagcttatctgctggggtgacagtgtcaaactacgttatgggaacaaaccagaagac
tgtccatatctttgggctcacatgaaaaaatacactgaaatgactgccaagtattttcat
ggagtgcgtctggacaattgccattcaacgcctcttcatgtagctgagttcatgatggat
gcggctagaaaactgcggcccaacttgtatgtagtagctgagctgttcacagggaatgag
gagctggacaatatctttgtgaataaactgggcattagctctttaataagagaggcaatg
agtgcatacaacagtcatgaagagggaagattagtttatcgctttggaggagacccagtt
gggtcttttgttcaaccacatttgagacccttaacgcctgctattgctcatgccctgttt
atggacataacgcatgataatgaatgtccaattcagcatcgatcagcttatgatgccctt
cccacctcaaccattgtctcaatggcctgctgtgctacaggaagcactcgaggatatgat
gagctggtaccacatcagatttctgtggttgatgaagaacgtttttacccaaaatggaat
ccagcagcaacacctttgacacctggtgaagttaacttcaaaactggaattatagcagga
aggctggctatcaacagactgcatcaagaattaggagcaagagcttttaaccaggtattt
gtagatcaagttgatgaagatattgtggctgtgacgaggcattgtcctaacacacatcag
tctgttgtagctgtttcccgaacagctttcagaaatcccaagacgtccttctatagtcaa
gaggttccccagatgtgtattccagggaagattgaagaagtggtacttgaggctaggact
gttgagagaaacgctggtccttataaaaaagacgagcatgcaatcaatggattgcccgac
tatacagttgagctccgagaacatattcagctcaccgaaagtaaaatcatacgacaagct
tcagttgctacaaaaggtcctaatgaatttgtccaagagatagaatttgaacagctaact
ccaggaagtgtaattatattcagagttagccttgacccaaaggcccaagatgctgtaggc
gtactccggaatcacctgatccagttcagtcctcactttaaatctggaagccttcccgat
gatggttcagaggctatactcaaaacaactttcttaaacattgcatcaaaattaaccttg
gcagacctgaaccaggtactatatcgctgtgattctgaggaacaagaggatggtggagga
tgttacaacataccaaactggacaccccttaaatacggtggccttcaaggaataatgtca
gtgatggcagacatacgaccaaagaatgatttggggcatcctttctgtggcaacctgcga
gctggagattggatgattgactatgtgagtgatcgtttaatcgctcgttccggagcctgc
tctgaagttggaaagtggctgaaagcaatgtttatctacttgaaacaagttcctcgttac
ctcattccatgttattttgatgccatattagttggtgcatatacaacacttcttgacttg
acttggaagcagatgtctaactttgttcagaatggctcgacgtttgttaaacatctttcc
ttgggttcagtccagatgtgtggaataggaaaatacccttctctgccacccctgtcgcct
gctttacaggatgttccttatcgtctgaatgaaattacaaaggaaagagaacagggctgt
gtttctttagcagctggtttacctcatttttcttctggaattttccgctgctggggaagg
gataccttcattgcactgcgggggctgatgttagtcacaggacggtacttggaagcaaga
aacatcattttagcatttggaagtaccttaagacatggcctcattcccaacttgcttggc
caagggacccatgccaggttcaattgccgggatgctgtgtggtggtggttgcagtgcata
caagattactgtaacttcgtttcaaatggcactgacattctcaagtgtcctatatccaga
atgtaccctacagatgactcccctcctctgccaccaggccaaagggaccacccactctat
gaactgatacaggaagctatgcagagacatatgcagggcatagacttccgagaaaggaat
gcaggtccgcagattgatcgaaatatgagagatgaaggatttaatgtgactgcaggtgtg
gatatggaaactggctttgtatatggagggaaccgttttaattgtggtacgtggatggat
aagatgggagagagtgacagagctcgcaacaaaggtattccagcaactccaagagatggc
tctgctgtagaaattgttggcttatgcaaatcaacagttcgttggctattggagttgtct
aagaagaatatatttccttattctggagttactgtaaaaagacatgggaaagaagagaca
gttacttatgatgcatggaacagaaaaatccaggcccacttcgaaaagctgttctttgtc
tccgagaatccatctgatcccaatgagaagcatcctactctggttcataagcggggtata
tataaggacagctatggagcctccagcccttggtgtgactatcagctaaggccaaatttc
cctatagcaatggttgtggcacctgaaatgttctccattgaacgtgcttggaaagcactt
gaaatgttggagcaaaagctacttggtccacttggcatgaaaactctagacccagatgat
atggtttactgtggtgtgtatgacaacgccttggacaatgacaactacaatgtggcaaga
ggatttaattaccatcaaggacctgaatggctttggcctattggatatttccttcgtgcc
aagttatacttttccaaattaattggtccagaaatctatgcaaagactgtcttcttggtt
aaaaatgtcctttctcgccattacgtacatctggagaggtcaccttggaagggtcttcca
gaactcactaatgaaaatggtcaatattgccctttcagctgtgaaacacaggcctggtca
attgctgtcatccttgaggttctctatgacttgtaa

DBGET integrated database retrieval system