KEGG   Anolis carolinensis (green anole): 100565667Help
Entry
100565667         CDS       T01608                                 

Definition
chymotrypsinogen B2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100565667
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100565667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 263 aa AA seqDB search
MAALWLLSCLALLSAAQGCGVPKIQPVISGYTRIVNGEEAVPGSWPWQATLQEKSGWHFC
GGSLVSERWVVTAAHCGVTTSNVVVLGEHDRSSSAEKVQKLAVEKVFIHPEWDPVAINND
IALIKLATPAELTDTVSPICLTDVTDEFKSGDLCATSGWGKTRYNAFTTPSKLQQTALPL
LSNEKCKESWGSNISDLMICAGAAGASSCMGDSGGPLVCQRDGAWELVGIVSWGSSRCSI
TTPAVYARVSRLREWAEETMANN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctctggcttctctcctgcctggcgcttctcagtgccgcccaagggtgtggc
gtgcccaagatccagcctgtcatcagcggctacacccgcattgtcaacggagaggaggcg
gtgcccggctcgtggccctggcaggctaccttgcaggagaaatccggctggcacttctgc
ggcgggtctctggtcagcgagcgctgggttgtgaccgcggcccattgcggcgtgacgacc
tccaatgtggtggtgcttggcgaacatgaccgcagctcttctgcagagaaagtacagaag
ctggccgtcgagaaggtcttcatccacccagaatgggaccctgtggccatcaacaacgac
atcgccttgatcaagctggccactccagccgagctgaccgacactgtctcccccatctgc
ctgaccgatgtcaccgacgagttcaagagcggagacctctgcgccaccagcggatgggga
aagacgcgctacaatgcgttcaccacccccagcaaactgcagcaaacggccctgccgctc
ctctccaacgagaagtgcaaagagtcctggggcagcaacatctccgacctgatgatctgc
gccggagcagccggggcctcttcgtgcatgggtgactccggcgggcccctggtctgccag
cgagacggggcctgggagctggtgggcatcgtgtcctggggaagcagccgctgctccatc
accaccccggccgtctacgcccgagtcagccgcctccgcgagtgggccgaggagaccatg
gccaacaactga

DBGET integrated database retrieval system