KEGG   Anolis carolinensis (green anole): 100565707Help
Entry
100565707         CDS       T01608                                 

Gene name
pdia4
Definition
protein disulfide isomerase family A, member 4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100565707 (pdia4)
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100565707 (pdia4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 641 aa AA seqDB search
MNMRRACLLTLLLAQLVLVAKCQEEEEEEEEAQGEESVFKDDDDDDDDDDDTEIKEENGV
LVLNDANFDTFVEGKDTVLLEFYAPWCGHCKQFAPEYEKIAKTLSENDPPIPVAKIDATS
ASTVSGRFDVSGYPTIKILKKGQPVDYEGSRTEAEIVAKVKEVSNPDWVPPPDATLVLTK
ENFDETVNEADIILVEFYAPWCGHCKRLAPEYEKAAKELRKHTPPISLAKVDAIAETDLA
TRFGVSGYPTLKIFRKGKSYEYNGPREKYGIVDYMIEQAGPPSKQIQAIKQVQEFVKDGD
DVIIIGVFKGNQDPAYQLYQDAANNLREDYKFYHTFSKEISSFLKVDPGNVVVMQPEKFQ
SKYEPKMHVLDIKESTDTEEVKSHVVKHALPLVGHRKTANDAKKYNKKPLVVVYYAVDFS
FDYRVATQYWRNKVLEVAKDFPEYTFAVADEEDYSSELKDLELVDSGEDVNAAIFDEGGK
KYAMEPEEFDSDVLRQFVLSFKKGKLKPIVKSQPVPKNNKGPVKIVVGKTFESIVMDPKK
DVLIEFYAPWCGHCKKLEPIYTELGKKYKNQKNLVIAKIDATANDVPSENYKVEGFPTIY
FAPSNNKKNPIKLESGERDLENLSKFVEEHATKLSRRKEEL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaggcgagcgtgtctgttgacgcttctcctggcgcagctggttcttgtagcc
aagtgtcaagaggaagaggaggaagaagaagaagctcaaggagaagagtctgttttcaaa
gatgatgatgatgatgatgatgacgacgatgatacagaaataaaagaggaaaatggtgta
ttggtgctgaatgatgcaaactttgatacttttgttgagggcaaagataccgtgctcctg
gaattctatgctccatggtgtgggcactgcaagcaatttgctccagaatatgaaaaaata
gccaaaacactgagcgaaaatgatcctcccatcccagttgctaagatagatgctacatca
gcttcgactgtgtctggtcgctttgatgttagtggctacccaaccatcaaaatcttgaag
aagggacaacctgtggattatgaaggctcaagaacagaagcagaaattgttgcaaaggtg
aaagaagtttcaaatcctgattgggtccctccaccagatgcaacattagtgttgaccaaa
gaaaactttgatgaaacagtgaatgaggctgacataattctggttgaattttatgctcca
tggtgtggacactgcaaaagattggctccagaatatgagaaagcagctaaggagcttagg
aagcatactcctcctatttctcttgcaaaagttgatgctattgctgaaacagatcttgca
acgaggtttggtgtatcaggatacccgacactcaagattttccgcaaaggcaaatcgtat
gagtacaatggtccaagagaaaagtatggaattgttgactacatgatagaacaggctggt
cctccatccaaacaaatacaggctatcaaacaggtacaagaatttgtgaaagatggagat
gatgtaatcatcataggagtgttcaaaggaaaccaagatccagcctaccaactttatcaa
gatgcagctaacaatctaagagaagattacaagttctatcatactttcagcaaagaaatt
tcaagctttctgaaagtggatcctggaaatgtggtagtgatgcaacctgaaaaatttcag
tcaaaatatgagcctaaaatgcatgttttggatattaaagaatcaactgatactgaggaa
gtgaaaagccatgtggtgaaacatgctttgcctcttgtaggccatcgcaagactgctaat
gatgctaagaaatacaataagaaacctctggtggtagtttactatgctgtagacttcagc
tttgattatcgagttgctacacagtattggcgaaacaaagttttagaggtagcaaaggac
ttcccagaatatacttttgctgtggctgatgaagaagattattcctcagagctaaaagac
cttgaactggttgatagtggagaggatgttaatgctgccatctttgatgaaggtggcaag
aaatatgcaatggaaccagaagaatttgattctgatgtgctgaggcaatttgttttgtca
ttcaaaaaaggaaaattaaaacccattgtgaaatctcaacctgtaccaaaaaataacaag
ggtccagtgaagattgtagttggaaaaacatttgagtctatagtgatggatcccaaaaaa
gatgtcctcattgagttttatgctccctggtgtggacactgcaagaaacttgagcccatc
tatactgagctgggtaaaaagtacaaaaatcagaaaaatctggtcattgccaaaattgat
gccaccgccaatgatgtccccagtgaaaattacaaagtggaaggattccctaccatctat
tttgctcccagcaacaacaagaagaatcctattaaacttgaaagtggagaaagagatctg
gagaacttgagcaaatttgtagaagaacatgccactaaactaagtaggagaaaagaagaa
ctttaa

DBGET integrated database retrieval system