KEGG   Anolis carolinensis (green anole): 100565730Help
Entry
100565730         CDS       T01608                                 

Gene name
ehmt1
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100565730 (ehmt1)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100565730 (ehmt1)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100565730 (ehmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1336 aa AA seqDB search
MERALMTKEDTRRDTCVKGELLKDITISKEEGFNAMAADESAIEKQVGEPKMAPDGETNG
SCECSDTKGHPGAAKNTQDGAKVSQGDSAAKLSRIAENGLLERDGLAGKQNHIKANDFTQ
TSVTGSNGYILSKQMAQEAPARTNSGAFASLPGHAAKTLPAGKGRTLSAFAQAALPTKHG
DGAKDGEGKKNTGAHGSMKVHRARKTLPKSPSDQNASQDSKEAKTPKEDGNTDMLEFGNP
ASLPPILGLHSSLPQNQSYVATSKSQTAASVSRKKKRRMGTYSLVPKKKTKVLKQRTMTE
MFKSIMQAASGVKGDKGDASLHVNGERLDMESEEEDSDELEEDDERGTDNPAAFPAEDNR
TAKEGDADASNTIKMVDGESEEDQDFGESAEEEEDGDESDLASAGVCSWLPRAKTRAWSA
QGRPRADGAAGEEQGRSPDRHGPGPSSAGGKSSESSLKKKMMKRKGKPESPWLKPTRKRR
RRSRKKKGGTLGPEAYKPPLGSGDGAQPESNMEYMEVSLDSLDLRVKGILSPQSEGLSNG
PEAAEADSLQEVPLCSCRMETPKSREITTLANNQCMATESIDKELSRCTNRVLKYELMRP
SNKVQLLVLCEDHRGRMVKHQCCPGCGFFCAAGTFMECQPESSISHRFHQDCASQVKGTS
YCPHCGEEASKAKEVTVAKADTTSTLPQSYEQKKPSVSEGRADTTTGSGIVTQTSEEARL
ENSSSEGFDLAGTSSFPKPAPPGLPQGPVKETLESALIALDSEKPKKLRFHSKQLYFSAR
QGELQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDVCHMLIQAGANIDTCSQDQR
TPLMEAAENNHLETVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLTNEEMDVN
CQDDGGWTPMIWATEYKHVELVKLLLAKGSDINIRDNEENICLHWAAFSGCVDIAEILLA
AKCDLHAVNIHGDSPLHIAARENRYECVVLFLSRGSDVTLKNKEGETPLQCSSLNSQVWV
ALQMNKTLKESSPDKPVQLEKTLSKDIARGYERIPIPCINAVDSEPCPTNYKYVSQNCVT
SPMNIDRNITHLQYCVCIDDCSSSKCMCGQLSMRCWYDRQDGRLLPEFNTAEPPLIFECN
HACSCWRTCRNRVVQNGLRARLQLFRTRNMGWGVRTMQDIPLGTFVCEYVGELISDSEAN
VREEDCYLFDLGNKDRDVYCIDARFYGNISRFINHFCEPNLIAVRVFMSHQDLRFPRIAF
FSSRHIQAGEEIGFDYGERFWNIKGKYFSCLCGSPKCRHSSAALAQRLASPSLSPEASEN
RLPDTSSTVAAASTPF
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atggagagagctcttatgactaaggaagataccagaagagatacctgtgtgaagggtgaa
ctcttgaaagatatcaccatcagcaaagaggaaggatttaatgctatggcagcagatgaa
agtgctatagagaagcaagttggggaacccaagatggcccccgatggcgagaccaacggc
tcttgcgagtgcagtgacaccaagggccaccccggtgcagctaagaacactcaggacggc
gcaaaagtgagccaaggggactccgcggccaagctgagccggatagcggaaaatggcctt
ttggagagagacggccttgccgggaagcagaaccacatcaaagccaacgactttacgcag
acgtcggtcacggggagcaatgggtacattttatcaaaacagatggctcaggaggcgccc
gccaggactaacagcggggcgtttgcttccctccctggccatgcggccaaaaccctccct
gcgggcaaggggagaacgttgagcgcctttgcccaggccgctctgccgacaaaacacggg
gacggcgccaaggacggcgaggggaagaaaaacacaggcgcacatggcagcatgaaggtt
catagagcgcggaagacgctgcccaaatctccctcggaccagaatgcaagtcaagactcc
aaagaagccaaaacaccgaaggaagatggcaacacagatatgttggaatttggaaacccc
gcttcgttgccccccatccttggccttcattcatctctacctcagaaccagagctatgtg
gccacctccaaatcgcagacagccgcttcggtatctcgcaagaaaaaacgaagaatgggg
acttacagcttggttcccaagaagaagaccaaagttttgaagcagcggacgatgaccgag
atgttcaaaagcataatgcaagccgcttctggtgtcaagggtgacaagggtgacgccagc
ctgcatgtgaatggagaaaggctagacatggagtctgaagaggaggattcggatgaactg
gaagaagacgacgaacgtgggaccgacaacccagccgcttttcctgcggaagacaaccgg
acggctaaagaaggggatgcggacgctagcaataccataaagatggtggacggcgaatct
gaggaggatcaagacttcggagagtctgccgaagaggaggaagacggtgatgagtccgat
ttggcctcggcaggggtctgctcttggttgccaagggccaagaccagagcgtggtctgca
cagggaaggccacgggcggacggagccgcaggcgaggaacagggacgtagtccggaccgc
catggtcccgggcccagttctgcaggaggcaagagttcggaatccagtctcaagaaaaag
atgatgaagcggaaagggaagccggagagcccttggttgaaacccacccggaaaaggcgg
cggagaagtcgaaagaaaaaaggtggcaccttaggtcccgaagcctataagccgcctctg
gggagcggagacggggcccagccggagagcaacatggagtacatggaggtctccctggat
tccttggatctccgagtgaaggggattctatctccgcaatcagaaggtctttccaacggt
cccgaagcggccgaagcagacagccttcaggaagtgcctctctgcagctgccggatggag
acgcccaaaagccgagagatcaccacgttagccaacaaccagtgcatggcgaccgagagc
atagacaaggagctgagccggtgcacgaaccgtgtgctgaaatacgagctgatgcgcccc
tcgaacaaagtccagctcctggtcctgtgcgaggaccatcgagggagaatggtgaagcat
cagtgctgccccggttgcggcttcttttgtgcagcgggcacgttcatggagtgccagccg
gagagcagcatctcacaccggttccaccaggactgtgcctcccaggtcaaaggcacgagc
tactgcccgcactgcggagaggaggcctccaaggccaaggaagtgacggtcgcaaaagcc
gataccacgtccacgctcccgcagagctacgagcagaagaaacccagcgtttcagaggga
agggcggacacaacgacaggaagtgggatcgtaacgcaaacatccgaagaggccaggctg
gagaattcctcttcagagggctttgacttggccgggacgtcttcctttcccaaaccggcc
ccgccaggtctgccccaaggaccggtcaaagaaaccttggaaagcgccttgatcgctctg
gattcggaaaagcccaagaaattgcggttccactccaagcagctgtatttctcggccaga
caaggggagttgcagaaagttctcctcatgctggtggacgggatcgatcccaatttcaag
atggagcaccagaacaagagaactcctctccacgctgctgcggagtctggacatgtggac
gtttgccatatgctcattcaggctggtgctaacattgacacatgctctcaggaccagagg
actccgctgatggaggcggcagagaacaaccatctggagactgtgaaatacctcatcaag
gccggagcgctagtcgatcccaaggatgcggaagggtccacttgtttgcacttggcagct
aagaagggccattacgacgtggtgcagtatctcctgaccaacgaagaaatggacgtcaac
tgccaggacgacggaggctggacgccaatgatctgggccacggagtacaaacatgtcgag
ttggtgaagctgctcctggccaaagggtccgacatcaacatccgagacaatgaagagaac
atttgtttacactgggcggcgttctcggggtgcgtcgacatcgcggagatcttgctggcc
gccaaatgtgacttgcacgcggtgaacatccacggggattcgcccctgcacatcgcggca
cgggagaaccgctacgagtgtgtcgtcctctttctgtctcgtggttcagatgtcaccctg
aagaataaggaaggggagacgccgctccagtgctcgagcctcaattctcaagtctgggtg
gccctgcagatgaacaagaccctcaaagagtcctctcccgacaaacccgtccagttggag
aagacactgagcaaagacatcgcccgaggttacgagcggatccccatcccgtgcatcaac
gccgtcgacagcgagccctgtcctaccaactacaaatacgtctcccagaactgtgtgact
tccccgatgaacatcgacaggaacatcacccatttgcagtactgcgtgtgcatagatgac
tgctcctccagtaaatgcatgtgtggacaactaagtatgcgctgctggtacgaccggcag
gacggccgtctcttgccagaattcaacactgcggagccccccttgatctttgagtgtaac
catgcctgttcttgttggaggacttgccggaaccgcgtggtccaaaacgggctccgggct
cggttacagcttttccggacgaggaacatgggctggggcgtgcggacgatgcaagacatt
ccattggggacctttgtgtgcgagtacgttggagagctgatttccgattccgaggcaaac
gtacgtgaagaagactgctatctttttgaccttggcaacaaggacagagacgtctactgc
atagatgcccgcttctatggcaacatcagccgcttcatcaaccatttctgcgagccaaac
ctcatcgccgtgcgcgtcttcatgtcccaccaggacctgcgcttccctagaattgccttc
ttcagcagcagacacatccaggcgggagaagagattgggttcgactacggcgaaaggttc
tggaacatcaagggcaagtacttcagttgcctgtgcggctccccaaagtgcaggcactcc
agcgccgccttggctcagcggctggcgagcccttcgctctccccggaggcctccgaaaac
agactccctgacaccagctcaacggtagcagcggccagcacccccttttga

DBGET integrated database retrieval system