KEGG   Anolis carolinensis (green anole): 100565792Help
Entry
100565792         CDS       T01608                                 

Gene name
tpi1
Definition
triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100565792 (tpi1)
   01230 Biosynthesis of amino acids
    100565792 (tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100565792 (tpi1)
   00051 Fructose and mannose metabolism
    100565792 (tpi1)
   00562 Inositol phosphate metabolism
    100565792 (tpi1)
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100565792 (tpi1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100565792 (tpi1)
  Exosomal proteins of bladder cancer cells
   100565792 (tpi1)
  Exosomal proteins of melanoma cells
   100565792 (tpi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 248 aa AA seqDB search
MAPRKFFVGGNWKMNGDKKSLGELIQTLNGAKVSGDVEVVCGAPTIYLDFARQKLDAKFG
VAAQNCYKVAKGAFTGEISPAMIKDIGATWVILGHSERRHIFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHLKLRGWLKSHVSDAVSQSTRIIYGGSVTGATAKELASQPDLDGFLVGGASLKPEF
VDIINAKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaggaagttcttcgtgggcggaaactggaagatgaacggcgacaagaagagc
ctcggggagctcatccagaccctcaacggggccaaggtctccggggatgtcgaggttgtt
tgcggcgctcccaccatctaccttgactttgcccgccagaagcttgatgccaaatttggt
gtggctgcacagaactgttacaaagtggccaagggagctttcacaggagaaatcagtcct
gccatgataaaggatattggagctacctgggtgatcttgggacactctgaaagaagacac
atctttggcgagtcagatgagctcattgggcagaaggtggcccacgccttggctgagggt
cttggtgtcattgcctgtattggggagaaactggatgagcgagaggctggcatcacagag
aaggtggtgtttgaacagaccaaggctattgctgataatgtgaaggattggagcaaagta
gttcttgcctatgagccagtttgggccatcggaactggcaaaactgcaacaccccaacag
gcccaggaagttcatttgaagttgcggggctggctgaagagccatgtgtctgatgctgtt
tcgcaatcaacccgaatcatctatggagggtcagtcacaggtgccaccgccaaagaactg
gcttctcaacctgatctggatggctttcttgttggtggagcctctctcaagcctgaattt
gtagatataatcaatgcgaaacactga

DBGET integrated database retrieval system