KEGG   Anolis carolinensis (green anole): 100565806Help
Entry
100565806         CDS       T01608                                 

Gene name
dhcr7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100565806 (dhcr7)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100565806 (dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 474 aa AA seqDB search
MAAHKETPFSEGGRNKSGMNGTGGSKGQWGRAWKVDWISLAGVIFLLLFAPLIVYYFIMA
CDQYNCSLTQPVIHVFMDKTHLLEIWNKTPPLTWKAATIYSTWVIFQVFLFMLPDFCHKF
LPFYQGGLQEGAVTPAGKVLKYHINGLQAWLITHALWFANAYHFHWFSPTVIFDNWIPLL
WCANILGYAVSVYVIIKAYYFPSNAKDCKFTGNFFYDFMMGIEFNPRIGEWFDFKLFFNG
RPGIVAWTLINLSYAAKQQELYGQVSNSMILVNVLQAVYVLDFFWNETWYLKTIDICHDH
FGWYLGWGDCVWLPYMYTLQGLYLVYHPVHLATGNAIGILLLGLVGYYIFRMTNHQKDLF
RRTDGNCKIWGKKPQYIECSYMSADGTKYYSKLLTSGFWGMARHFNYTGDLMGSLAYCLS
CGLQHILPYFYIIYMTILLVHRCIRDEHRCSSKYGKDWKRYTDAVPYRLLPGLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcataaggaaacaccattttctgaaggaggaagaaataaaagtggcatgaat
ggaacaggaggttctaaaggacaatggggtagagcatggaaagttgactggatttcttta
gcaggtgtcatctttctactcctatttgcacccctcattgtgtattattttataatggca
tgcgatcaatacaattgctctctgactcaaccagtcattcacgtgttcatggacaaaacc
caccttttggaaatctggaacaaaacaccaccattgacttggaaagctgcaaccatctat
agcacctgggtaattttccaggtatttttgtttatgcttcctgatttttgccacaagttc
cttccattctatcagggaggattgcaagaaggggctgtgacaccagccggcaaagtgctc
aaatatcatatcaatggactacaagcctggcttatcactcatgcactatggtttgcaaat
gcctaccactttcactggttctcacccactgtcatttttgacaattggatcccattattg
tggtgtgcaaatattctgggctatgccgtgtctgtttatgtaattataaaagcatactat
ttcccatccaatgcaaaagattgtaaattcactggtaacttcttctacgacttcatgatg
ggaattgaatttaatcctcgtataggagagtggtttgatttcaaactgtttttcaatggt
cgcccaggcattgtagcatggactcttattaacctctcctatgcagcaaaacagcaggaa
ctatatggacaagtatctaattctatgatacttgtcaatgtcctacaggctgtgtatgtt
ttggacttcttctggaatgaaacctggtacttgaaaacaatcgacatttgccatgatcat
tttggatggtacctgggatggggagattgtgtttggcttccttatatgtatactttgcag
ggattgtacttggtctaccatcctgttcatcttgccacaggaaatgcaattggaattctg
cttttaggactagtgggctactacattttcagaatgacaaatcatcagaaagatctcttt
cgtcgcactgatggcaactgtaagatatggggcaaaaagccgcaatacattgagtgctcc
tacatgtcagctgatggaaccaaatactacagtaaactgttgacttcaggattctggggg
atggcccgccattttaactacacaggagacttaatgggctctctggcatactgcttgtcc
tgtggtcttcaacacatcctgccttatttctacatcatttacatgaccattcttcttgtc
catcgctgcatcagggatgaacaccggtgttccagcaagtatgggaaggactggaagcgg
tataccgatgcagtgccataccgactgcttccaggtttattttaa

DBGET integrated database retrieval system