KEGG   Anolis carolinensis (green anole): 100565814Help
Entry
100565814         CDS       T01608                                 

Gene name
mapk9
Definition
mitogen-activated protein kinase 9
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100565814 (mapk9)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100565814 (mapk9)
   04012 ErbB signaling pathway
    100565814 (mapk9)
   04310 Wnt signaling pathway
    100565814 (mapk9)
   04068 FoxO signaling pathway
    100565814 (mapk9)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100565814 (mapk9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100565814 (mapk9)
   04621 NOD-like receptor signaling pathway
    100565814 (mapk9)
   04622 RIG-I-like receptor signaling pathway
    100565814 (mapk9)
  Endocrine system
   04910 Insulin signaling pathway
    100565814 (mapk9)
   04920 Adipocytokine signaling pathway
    100565814 (mapk9)
   04912 GnRH signaling pathway
    100565814 (mapk9)
   04914 Progesterone-mediated oocyte maturation
    100565814 (mapk9)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100565814 (mapk9)
   05168 Herpes simplex infection
    100565814 (mapk9)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100565814 (mapk9)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100565814 (mapk9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 424 aa AA seqDB search
MSESKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSDSDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERNKNGLVKEQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGTL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagtaaatgtgatagtcagttttacagtgtacaagttgcagattcaacgttt
actgtactaaaacgataccagcaattgaaacctattggttctggggcgcaaggcattgtt
tgtgctgcatttgatacagtccttggaataaatgttgctgttaagaaactgagtcgccct
tttcaaaaccaaacacatgcaaaacgagcctacagggaacttgtactcttaaagtgtgtc
aatcataaaaatattattagtctattaaatgtattcacaccccagaaatcactagaagaa
tttcaagatgtgtatttggttatggaactgatggatgctaatttgtgccaagttattcat
atggaactggatcatgaaagaatgtcctaccttctatatcagatgttatgtggtatcaaa
catcttcattcagctggtatcatccacagagatttaaaacccagcaatatagtagtaaag
tcagattgtactcttaaaatccttgactttggcctggcaaggacagcatgtactaatttc
atgatgactccatatgtggttacacgatattacagagcaccagaagttattcttggaatg
ggatacaaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgaccagtggaataaagttattgaacag
ttaggtacaccatcagcagaatttatgaagaaactacagcctactgtgaggaactatgta
gaaaatagaccaaaatatccaggtattaaatttgaagagctcttcccagactggatattt
ccatcagactccgatcgtgacaaattaaaaactagtcaggctagagatttgctttcaaaa
atgctagttgtagatccagacaaacgaatttcagtagatgaagctttacgtcacccctat
atcactgtttggtatgacccagctgaagctgaagctccaccacctcaaatctatgatgca
caattggaagaaagggaacatgccattgaagaatggaaagaactaatttataaagaagta
atggattgggaagaaagaaataagaatggtttagtaaaagaacaaccttcagatgcagca
gtgaatagcaataccagcccttctcagtcatcatcaatcaatgacatttcatccatgtca
acagaacaaacactggcttcagacacagacagcagccttgatgctttgacaggaacactt
gaaggatgccggtga

DBGET integrated database retrieval system