KEGG   Anolis carolinensis (green anole): 100565834Help
Entry
100565834         CDS       T01608                                 

Definition
alpha-type platelet-derived growth factor receptor-like
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100565834
   04020 Calcium signaling pathway
    100565834
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100565834
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100565834
  Cell motility
   04810 Regulation of actin cytoskeleton
    100565834
  Cell communication
   04510 Focal adhesion
    100565834
   04540 Gap junction
    100565834
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100565834
Protein kinases [BR:acs01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100565834
Enzyme-linked receptors [BR:acs01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100565834
Cytokine receptors [BR:acs04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100565834
Cellular antigens [BR:acs04090]
 Proteins
  100565834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1088 aa AA seqDB search
MMGPSQRTYLILGCFLTGPWLASCQTLFPTIFPNKDEMEVHLNSPFTLKCSGDSEVNWQH
PIPEDNDTIDIRNEENNSGLFVTVLEVKNASASHTGLYTCYYNHSQEEEGEVEGKDIYIF
VPDPAVPFVPTSPEDSIIVITEEDETSTIPCRTSDPHAQVTLTNSEGKVVYTFYDNRQGF
IGNFSAGSYTCRTTVKAVEFLSGEFFVYVYKATSHLQVEVGSLKTVYKTGETIVVTCVVL
DNEVVNLEWKYPGKVRNRGIISLEDIKVPAQKLIYNLTIHDASVSDSGDYECAAHHVTKE
LKKTKRTIITVHDKGFIRLEPHFNPMETVNLHEVKKFVVGVHAYPEPRIFWLKDNITLME
NLTEIVTSFKQIQETRYQSVLKLIRAKEEDSGYYTLVAQNEDEIQRYTFSLLIQVPALIR
DLVDNHHGSAGQTVKCLAEGTPLPDVEWLICKDIKRCSNDTSWTPLTNNISDITMETHLD
ERNMVESQVTFQKVQETLAVRCLARNDLGTVARELKLVAPTLRSELTLAAAILVLLVFVI
ISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARTSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRNPEKTKKDLDIFGMNSADESTRS
YVILSFENNGEYMDMKQAETTQYVPMLERRDRSKYSDIQRSLYDRPASYKKKYLSEQDVL
NLLSDDNSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMTKPDHATSEVYDIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYK
KSYERIHLDFLKSDHPAVTRMRADCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYII
PLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFVKREDETIDDIDIIDDIGMDSS
ELVEDSFL
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtccttctcaaaggacatacctgatcctgggctgcttcttgacaggtccatgg
ttagcctcctgccagactttgtttcctactatttttccaaacaaagatgaaatggaggtg
catctgaattcccccttcaccttgaaatgttccggagacagtgaagtaaactggcagcac
ccaatacctgaagacaatgatactatagacatcagaaatgaagaaaacaatagcggcctt
tttgtcactgtgctggaagtcaaaaacgcatctgcttcccatactggactgtatacttgc
tactacaatcattcccaagaagaagaaggggaggttgagggaaaggatatctatatcttt
gtgccagatccagctgtcccctttgtccctacatctcctgaagattcaatcattgttatt
actgaagaagatgagacctccaccattccttgccgcacgagtgatcctcatgctcaagta
actttaacaaacagcgaagggaaagtcgtgtacaccttttatgacaacaggcaaggcttc
attggaaacttctctgcaggctcctatacatgcaggaccactgtgaaggccgtggagttc
ctgtctggtgaattttttgtctacgtttacaaagcaacttcacatcttcaagttgaggtt
ggatcccttaagactgtgtataaaacaggagaaacgattgttgtaacttgtgtggtcttg
gataatgaagttgtgaacttggagtggaaatatccagggaaagtgaggaacagaggtatc
atctcactcgaagacatcaaagtgccagcccagaaactgatttataacttaaccattcat
gatgcttcagtaagcgacagtggagattacgaatgtgcagctcatcatgtcaccaaagag
ttaaagaaaacaaaaagaaccatcattacagttcatgataaagggttcattcgtctggag
ccccattttaatcccatggaaacagtcaatctgcatgaagttaaaaaatttgtagttggt
gtgcatgcatatccagagccaagaatcttttggctaaaggacaatatcactctgatggag
aatctcaccgagattgtcactagtttcaagcagatccaggagacgaggtaccagagtgtg
ttaaaattaattcgtgccaaggaagaagacagtgggtactacactcttgtagcacagaat
gaagatgaaattcaaagatatactttctctctgcttatacaagtgccagctttaattcga
gacctagtagataatcaccatggctctgctgggcaaactgtgaaatgcttggctgaaggg
acacctctccctgatgtggaatggttgatttgcaaggatataaaaaggtgcagcaatgat
acttcgtggactcccctgactaacaatatctctgatattactatggagactcatctggat
gagaggaacatggtagagagccaggtgacttttcagaaggtgcaagaaacgttggctgtt
cgatgcctggcaaggaatgaccttggaaccgtagcacgggaactgaagcttgtggctcca
actttaagatcagaattgactctggctgccgcaatcctagtgttgctagtgtttgtaata
atttcgctgattgtcctggttatcatatggaaacagaagccaagatacgaaattagatgg
agagtcatcgagtctatcagcccagatggccatgaatatatatatgtggatcccatgcag
ctgccttatgattcaagatgggaatttcctagagatggattagtgctgggccgaattctt
ggctccggagcttttggaaaagtagttgaaggaaccgcatatggattaagtcggtcacag
cctgtcatgaaggtggctgtgaaaatgctgaagcccactgcacgaaccagtgaaaagcag
gctctcatgtctgaattaaagataatgacccatcttggaccccacttgaacatagtcaac
ctgttaggagcatgtacaaaatcaggtccaatttacatcataacagaatactgcttttat
ggagacttggtgaactatctgcataaaaacagggacaactttctgaaccgaaaccctgaa
aagacaaagaaagatttggacatctttgggatgaactcggctgatgaaagcactaggagc
tatgtcatcctgtcatttgaaaataatggtgaatacatggatatgaagcaagcagagacc
acacagtatgtgccgatgctagaaaggagagacaggtcaaaatattctgacatccagaga
tctctgtatgatagacctgcttcatataagaaaaaatatctgtctgaacaagatgttctg
aatcttctttcagatgataattcagaaggcctcagtttgctggacctattgagctttacc
taccaagttgcccggggaatggagttcttagcatcgaaaaattgtgtacaccgtgatttg
gcagcaaggaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttggtctg
gctagagatattatgcatgattcaaactatgtctccaaaggcagcaccttccttccagtg
aagtggatggcacctgagagcatttttgacaacctatatacaacattaagtgatgtttgg
tcttatggcattctgctctgggaaatattttctcttggtggcaccccatatcctggcatg
atggttgattctacattctataacaaaatcaagagtggatatcgaatgacaaaacctgac
catgctaccagtgaagtgtatgacatcatggtaaaatgctggaacagcgaacctgagaag
agaccctctttttaccacttgagtgaaatagttgagaatcttttgcctggagaatacaag
aagagctatgagagaattcacttggacttcctgaagagtgaccatcctgctgtcacacgc
atgcgagcagactgtgacaacacttacattggtgttacttacaaaaatgaagacaaactg
aaagatagggagagcggctttgatgaacaaagactaagtgctgacagtggatacatcatt
cctctgccggatattgaccctgtctcagaagatgaacttggcaaaaggaacaggcatagt
tcccagacctctgaagaaagtgccattgaaaccggatccagcagttcgacctttgtcaag
cgagaggatgaaaccattgatgacatcgacattattgacgacattggcatggattcctcc
gaattggttgaggacagcttcctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system