KEGG   Anolis carolinensis (green anole): 100565867Help
Entry
100565867         CDS       T01608                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 328 aa AA seqDB search
MASGEAFKSPSRPSARRLSGQSSPSTSITIPASPFMQKLGYGTGVSVYLMKRSPKGLPCS
PWAVKKVNPGCDSNQRDTYQKRLNEEASILKNLQHPNIIGYRAFTEAKDGTMCLAMEYGG
EKSLNDLIEERQERGLGPFPPETILKVALHMARGLKYLHNEKKLLHGDIKSPNVVIKGDF
ESIKICDVGVSLPLDENMTVSDPEAVYIGTEAWKPKEVLEEGGHAVITDRADIFALGLTL
WEMMTLSVPHVNLPEDDGEDPDASFDEDDFDDEAFYEALGTRPALNVEALGPAYQTVIEL
FALCSMEEASQRPSAAHIVEVLEANGTV
NT seq 986 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgggagaggccttcaagagccccagcaggccctccgcgcggaggctgtccgga
cagagcagcccttcaacctccataactattccagcttctcctttcatgcagaagcttggc
tatgggactggagtcagtgtttaccttatgaaaaggtctccaaaaggcctcccttgctct
ccctgggcagtaaagaaagtcaatcccggatgtgactccaaccagagagatacgtatcaa
aagaggctgaatgaggaagccagcattctgaaaaacctccagcaccccaacatcatcggg
tatcgtgccttcactgaagccaaggatgggaccatgtgcctggccatggagtacggggga
gagaagtctctcaacgacctcattgaagaaaggcaggagaggggcttggggcccttcccg
cccgagaccatcctcaaggttgccttgcacatggcaagggggctgaagtatcttcacaac
gagaagaaattgcttcacggcgacataaaatcccccaatgttgtcattaagggtgacttt
gagtccataaagatctgcgatgttggtgtttccctgcctctggatgaaaacatgaccgtg
agcgacccggaggccgtgtacattggcaccgaggcctggaagcccaaggaagtcttggag
gagggcggtcacgctgtcatcaccgaccgggcggacatctttgccttggggctgaccctg
tgggagatgatgaccctctcggtgccccacgtgaacctgccagaggacgacggcgaggat
ccagacgcgtcttttgacgaagacgactttgacgacgaggccttttacgaggcgctgggg
acccgcccggccctcaacgtggaggcgctgggccccgcttaccagacggtcatcgagctc
tttgccctctgctccatggaggaggccagccagcgcccctcggccgcccacatcgtggag
gtcctggaggccaacggaactgtgca

DBGET integrated database retrieval system