KEGG   Anolis carolinensis (green anole): 100565870Help
Entry
100565870         CDS       T01608                                 

Definition
histone acetyltransferase KAT5-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100565870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
NKRLDEWVTHDRLDLKKIQFPKKEAKTPTKNGLPGSRPSSPERDVPAAAPSSGKTLPIPV
QITLRFNLPKEREAVPGSPDQPLSSSSCVQPNHRSTKRKVEVVSPATPIPAPTETTQASV
FPQNGSARRAVATQPGRKRKSNCLGTDEDSQDSLDGLPSAPRMTGSLVSDRSHDDIITRM
KNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYVKSLKCLQRHLTKCDLRHPP
GNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGF
HIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDL
GLLSYRSYWSQTILEILMNLKSETGERPQITINEISEITSIKKEDVISTLQYLNLINYYK
GQYILTLSEDIVDGHERAMLKRILRIDSKCLHFTPKDWSKRGKW
NT seq 1397 nt NT seq  +upstreamnt  +downstreamnt
tcaacaagcggctggacgaatgggtgacccacgaccggctggacctgaagaagatccagt
tccccaagaaggaggccaagacccccaccaagaacgggctgcccggctcgcggcccagct
ctccggagcgggacgtgccagccgcagccccgtccagcgggaagaccctgcccatcccgg
tccagatcacgctccgcttcaacctgccgaaggagagggaggccgtccccggctcccccg
accagccgctctcctccagctcctgcgtccagcccaaccatcgctccacgaagcggaagg
tggaggtggtgtctcccgcgacccccatcccagcgcccacagagaccacccaggcctccg
tcttcccgcagaatggctctgcgcgccgtgcggtggccacgcagccgggcaggaagcgca
agtccaactgcctgggcacggacgaggactcccaggacagcctggacggcctgccctcgg
cgccccgcatgaccggcagcctggtctcggaccgcagccacgacgacatcatcacgcgca
tgaagaacatcgagtgcatcgagctgggccggcaccgcctgaagccctggtacttctccc
cgtacccgcaggagctcaccacgctgcccatcctctacctctgcgagttctgcctcaagt
acgtcaagagcctcaagtgcctccagaggcacctgaccaagtgcgacctgaggcacccgc
ccgggaacgagatctaccgcaaggggaccatctccttcttcgagatcgacgggcgcaaga
acaagagctactcgcagaacctctgcctgctggccaagtgcttcctggaccacaagaccc
tctactacgacacggaccccttcctcttctacgtcatgaccgagtacgacagcaagggct
tccacatcgtcggatacttctccaaggagaaggaatccacggaggactacaacgtggcct
gcatcctgaccttgcctccctaccagagacgcggatacggcaagttgctgattgaattca
gctacgagctgtccaaggtggaggggaagacgggcaccccggagaagcccctctcggacc
tggggctcctctcctaccgcagctactggtcccagaccatcctcgagatcctcatgaacc
tcaagtcggagaccggggagcgcccacagatcaccatcaacgagatcagcgaaatcacga
gcatcaagaaggaggacgtcatctccaccctccagtacctcaacctgatcaactactaca
agggccagtacatcttgacgctctcagaggacattgtggacgggcacgagcgcgccatgc
tcaagcggatcctgcgcatcgactccaaatgcctgcacttcacccccaaagactggagca
aaagagggaagtggtga

DBGET integrated database retrieval system