KEGG   Anolis carolinensis (green anole): 100565870Help
Entry
100565870         CDS       T01608                                 

Gene name
kat5
Definition
(RefSeq) lysine acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100565870 (kat5)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100565870 (kat5)
   HAT complexes
    TIP60 complex
     100565870 (kat5)
    NuA4 complex
     100565870 (kat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 523 aa AA seqDB search
MAEVEEVTEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
DRLDLKKIQFPKKEAKTPTKNGLPGSRPSSPERDVRKTLDLSLQPAAAPSSGKTLPIPVQ
ITLRFNLPKEREAVPGSPDQPLSSSSCVQPNHRSTKRKVEVVSPATPIPAPTETTQASVF
PQNGSARRAVATQPGRKRKSNCLGTDEDSQDSLDGLPSAPRMTGSLVSDRSHDDIITRMK
NIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYVKSLKCLQRHLTKCDLRHPPG
NEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFH
IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLG
LLSYRSYWSQTILEILMNLKSETGERPQITINEISEITSIKKEDVISTLQYLNLINYYKG
QYILTLSEDIVDGHERAMLKRILRIDSKCLHFTPKDWSKRGKW
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggaggaggtcaccgagggctgccgcctgcccgtcctgcgccggaaccag
gacaacgaggacgagtggccactggccgaaatcctcagcgtcaaggacatcagcggccgg
aagctgttctacgttcactatattgacttcaacaagcggctggacgaatgggtgacccac
gaccggctggacctgaagaagatccagttccccaagaaggaggccaagacccccaccaag
aacgggctgcccggctcgcggcccagctctccggagcgggacgtgaggaagaccttggat
ctgtctctgcagccagccgcagccccgtccagcgggaagaccctgcccatcccggtccag
atcacgctccgcttcaacctgccgaaggagagggaggccgtccccggctcccccgaccag
ccgctctcctccagctcctgcgtccagcccaaccatcgctccacgaagcggaaggtggag
gtggtgtctcccgcgacccccatcccagcgcccacagagaccacccaggcctccgtcttc
ccgcagaatggctctgcgcgccgtgcggtggccacgcagccgggcaggaagcgcaagtcc
aactgcctgggcacggacgaggactcccaggacagcctggacggcctgccctcggcgccc
cgcatgaccggcagcctggtctcggaccgcagccacgacgacatcatcacgcgcatgaag
aacatcgagtgcatcgagctgggccggcaccgcctgaagccctggtacttctccccgtac
ccgcaggagctcaccacgctgcccatcctctacctctgcgagttctgcctcaagtacgtc
aagagcctcaagtgcctccagaggcacctgaccaagtgcgacctgaggcacccgcccggg
aacgagatctaccgcaaggggaccatctccttcttcgagatcgacgggcgcaagaacaag
agctactcgcagaacctctgcctgctggccaagtgcttcctggaccacaagaccctctac
tacgacacggaccccttcctcttctacgtcatgaccgagtacgacagcaagggcttccac
atcgtcggatacttctccaaggagaaggaatccacggaggactacaacgtggcctgcatc
ctgaccttgcctccctaccagagacgcggatacggcaagttgctgattgaattcagctac
gagctgtccaaggtggaggggaagacgggcaccccggagaagcccctctcggacctgggg
ctcctctcctaccgcagctactggtcccagaccatcctcgagatcctcatgaacctcaag
tcggagaccggggagcgcccacagatcaccatcaacgagatcagcgaaatcacgagcatc
aagaaggaggacgtcatctccaccctccagtacctcaacctgatcaactactacaagggc
cagtacatcttgacgctctcagaggacattgtggacgggcacgagcgcgccatgctcaag
cggatcctgcgcatcgactccaaatgcctgcacttcacccccaaagactggagcaaaaga
gggaagtggtga

DBGET integrated database retrieval system