KEGG   Anolis carolinensis (green anole): 100565879Help
Entry
100565879         CDS       T01608                                 

Definition
(RefSeq) aldehyde oxidase 3
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100565879
   00350 Tyrosine metabolism
    100565879
   00380 Tryptophan metabolism
    100565879
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100565879
   00760 Nicotinate and nicotinamide metabolism
    100565879
   00830 Retinol metabolism
    100565879
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100565879
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100565879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1324 aa AA seqDB search
MAYLQQSDELIFFINGKKVIEQCADPEELLLNYLRKGLRLTGTKYGCGIGGCGACTVMIS
TYNADSKKIRHYPANSCLLPLCSLYGLAVTTVEGVGSTTTKLHPIQQRLAKCHGSQCGFC
TPGMVMSMYSLLRNHPEPSMEQITAALDGNLCRCTGYRPIIDSFSAFSPESCPLAGSGKC
CMDKEEKETKGSDSGEEDPSLHPEKGNRMCSGLCKPEEFHPRDPTQDYIFPPELMVSDQS
SINICCKVENPASASPSPFSGGIDKKLLGIWYPVLLHPVRIPELHVVTMGENGIVIGAAT
HLAQLRDILLSLVPELPAEKTKIYRTLLKQLRTLAGEQIRSLASLGGHIVSRGSVWDLNP
VLAAGNAVLNLASIDGTRQIPLNDEFLTKVPEADLSPMEVIVSVFIPFSKEDEFISAFRQ
AERRKNALSVTNSSMKVLFQPGTDVIEDLAIFYGGISDTTVSARNSCLKLKGRNWNDQFL
DEACRLILEEVVVSPSAPGGKVEYRRSLLVSFFFRFYLEVLHSLKMMYPFQYPDLPKEYM
SALSEFQEKPPQGMQIYQDVNPHQLPQDPVGRPIMHESGIKHTTGEAVYVDDIAPADGQL
YMAVVTSTRAHAKILSIDTSNALEEPGVVAVVMACDIPGENGDADEKVFAEDEVIYIGDI
ICGIVAETYECARNARSKVKIEYQDLELILTIEEAIEHNSFLSKEKKIEKGNVEDAFETV
DKILEGEIHVGGQEHFYLETNSIFVIPRKEDKQMDLYVSTQDASNAQELVASVLDVPANR
ITCHTRRVGGAFGGKGLKTSYFVAAAAVAAHKTGCPVRFILERDDDMRITGGRHPLWGKY
KVGFMTDGKIKAVDLEFYVNGGCTLDESELVIEYVLLKCPNAYDIQNFRCRGRACKTNLH
SNTSLRGFGFAQAGLSAETWIAAVADYLYLPHDEVREMNMYKNVTETPYKEEIDPTNLVV
CWEECLEKSDYYKRRQAAEEFNKQNYWKKKGIAIIPMKFSVGYNETFYHQAFALVHIYLD
GSVLVSHGGCEMGQGLYTKMLQVASHELKIPLSYIHNYERTTATIPNAIVTSGSIGTEVN
GKAVQNACQILRKRLEPIMEKNPDGKWENWIKEAYEGSISLTATGYFKGYPTNMDWEKGE
GHAFPYFVFAAACSEVEIDCLTGDHENIRTDIVMDASFSINPAIDIGQIEGGFIQGLGLY
TMEELKFSPEGELYTLGPDTYKIPAVCDVPEHFRVYLLPNSRNPIAIYSSRGMGEAGVFL
GSSVFFAIRDAVAAARKERGLNRNFTLNSPLNVERIRMVCADRFTEMIPRDIPGTYQPWE
IHVD
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccttcagcaatctgatgagcttatcttttttatcaatggcaaaaaggtgata
gagcagtgtgctgatccagaagaattgctgcttaattatctgagaaaggggctccgtctc
acaggaactaagtacggctgtggaattggaggctgtggggcctgcaccgtgatgatttct
acatacaacgcagactccaagaaaatacgacattatccagccaactcttgcctcctcccg
ctctgctcattgtatggtctcgcagtaaccactgtggaaggagtggggtccacaacaacc
aagctgcaccccattcagcaaaggcttgcaaagtgccatggctcccagtgtggcttctgc
actcctggaatggtgatgtccatgtattccttactaagaaaccaccctgaacccagcatg
gagcagataaccgcagctctggatgggaatttgtgccggtgtacaggatacagacctata
atcgacagcttcagtgctttttccccggagagttgcccattggcagggagtgggaagtgt
tgcatggataaagaagagaaggagacgaaaggcagtgattctggtgaagaagacccatca
ttgcatcctgaaaagggaaacaggatgtgctcaggtttatgcaagccagaggaattccat
ccaagggatccaacccaggattacatatttcctcctgaactcatggtaagcgatcagtct
tccatcaatatttgctgcaaagtagaaaatcctgcaagtgcctctccttcaccattttct
ggcggaattgataagaaacttctgggcatttggtatcccgttctccttcacccggtcagg
attccagagttgcatgttgtcaccatgggagaaaacggcatcgtaattggtgcagccacc
cacttggctcagctgagagacatcctattgagccttgtccccgaactcccagcggagaag
acaaagatataccggacactcttgaagcagctgaggactctggctggagaacagatcagg
agtttggcttctttaggaggacacattgtaagcaggggatcggtctgggatctgaaccct
gttctggcagctgggaatgctgttctcaatctggcatcaatagatggaacacgacagatt
ccactgaatgatgaattcctcacaaaagtgccagaggcagatctctccccaatggaggtc
attgtttctgtttttattccattctcaaaggaagatgaatttatctcagccttccgacag
gctgagcgtcggaaaaatgccttgtcagtgacaaattcttccatgaaggtcctcttccag
ccaggcactgatgtcattgaagacctggctattttttatggaggcattagtgatacaact
gtgagtgcaagaaattcctgcctgaaactcaaaggaagaaattggaatgaccagttcctt
gatgaagcttgcaggctaattcttgaagaagttgttgtgtctccttcggcaccaggcggg
aaagtggaatatcggcgctccctgcttgtcagcttcttcttcaggttttacttggaagtg
ctgcacagtttaaagatgatgtatcccttccaatatcctgacttgccaaaggaatacatg
agtgctttaagcgagttccaagagaagccaccgcaaggaatgcaaatataccaggatgta
aaccctcatcagcttcctcaggacccagttgggcgtcccatcatgcacgagtctggtatt
aaacataccaccggtgaagcggtctatgttgatgatattgctccagcagatggacagctc
tatatggctgtggtcaccagcacacgagctcatgcaaagatactatccattgatacatca
aatgctttggaagagccaggggtagttgctgtggtaatggcttgtgatattccaggagaa
aatggtgatgcagatgagaaagtgtttgcggaagatgaggtaatctacatcggagacatt
atctgtggtatagttgcagaaacctatgaatgtgcaaggaatgccagaagcaaagtgaag
atagagtatcaagatctagaactgattctgaccattgaggaggcaatagagcataattca
ttcctgtcaaaagaaaagaaaatagaaaagggaaatgttgaagacgcctttgagacagtt
gacaaaatcctggaaggtgaaattcatgttggaggccaagaacatttttacttagaaaca
aatagtatatttgtcattccaagaaaagaggataagcagatggatctgtatgtttctaca
caggatgcttcaaatgcacaagaattggtggcttcagtgttagatgttccagccaatagg
atcacgtgccacacaagacgagtgggaggagcttttggaggcaaaggattaaaaacatca
tattttgtagcagctgcagcagtagctgcccataaaactggctgtcctgtccgttttatc
ctggagcgagatgatgacatgcgaataactggaggtcgacatcctctttggggaaaatac
aaagtgggattcatgactgatggtaaaattaaagctgttgatctggagttctatgtaaat
ggtggttgtacactggatgaatctgaattggttattgaatatgttttgctaaaatgtcct
aatgcatatgacattcaaaacttccgatgccgtggacgggcctgcaaaactaatctgcac
tcaaacacgtcacttcgaggatttggatttgcacaggcaggtctttctgctgagacctgg
atagcggctgtggcagattatctttacttgccacatgatgaggtcagagagatgaacatg
tacaaaaatgtgactgaaactccctacaaagaagagattgatcccacaaatctggttgtg
tgttgggaagaatgtttagaaaaatcggattattacaagaggcgacaagctgcagaggaa
tttaacaaacagaactactggaagaagaaaggaatcgcaatcattccaatgaagttttct
gttggatataatgaaacattttaccaccaggcttttgctctggttcatatctatcttgac
ggttcagtgctggtgtcccatggtggctgtgaaatgggacaaggactttacaccaagatg
ttacaggttgccagccatgaattaaaaatacctttgtcgtatatacacaactatgaaaga
actacagctaccatacctaatgcaattgtcacctcaggatcaataggcacagaagtcaat
ggaaaagcagtacagaatgcttgccaaatcctcagaaagcgcctagagccaataatggaa
aaaaatccagacggaaaatgggagaactggataaaggaagcttatgagggaagcatcagc
ctcacagctactggttacttcaaaggctatcccaccaacatggactgggagaaaggagaa
ggccatgcatttccatactttgtttttgcagctgcttgttcagaggttgagattgactgc
ctgacaggtgaccacgagaacatccgcacagacattgtcatggatgcctctttcagcatc
aatccagctatagacataggccagattgaaggtggatttattcagggacttggactttat
acaatggaagaattaaagttttctcctgaaggagagctgtacacactgggcccagataca
tacaaaattcctgctgtctgcgatgtcccagaacactttagagtctacttgctgccgaat
tccagaaacccaattgcaatctactcctccaggggtatgggagaagctggagtgttccta
ggatcctctgtgttttttgctataagggatgcagtggctgctgcccggaaagagcgagga
ctaaaccgcaattttaccctgaacagtcctctgaatgtagagaggattcgcatggtctgt
gctgatcgctttacagagatgattccaagggatatccctgggacctatcagccatgggag
atccatgtggactag

DBGET integrated database retrieval system