KEGG   Anolis carolinensis (green anole): 100565990Help
Entry
100565990         CDS       T01608                                 

Definition
serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:acs03015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:acs04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:acs04910]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:acs04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:acs04270]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:acs05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MADSDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatagcgacaagctcaacatcgacagcatcatccaacggctgcttgaggtgaga
ggatcgaaacctggcaaaaatgtccagcttcaagaaaacgaaatcagagggttgtgcttg
aaatctcgggagatctttctcagtcagcccattcttttggaacttgaagcaccactgaaa
atatgtggtgacatccatggacaatactatgacttacttcgactctttgaatatggagga
tttccaccagaaagcaattacctgttccttggtgattatgtcgatagagggaagcagtcc
ttggaaacgatttgcctcttactggcctacaagataaaatatcctgagaattttttcctc
cttagagggaaccatgaatgtgctagcattaatagaatttatggcttttatgatgaatgt
aaaagaagatacaacatcaagctgtggaaaacttttacagactgctttaattgcttacca
attgcagccattgtggatgagaaaatattttgctgccatggaggcttatcaccagacctc
cagtccatggaacagatccggcggattatgcgtcctaccgatgtgcccgatcaaggcctt
ctctgtgatctgctgtggtctgatccagataaggatgtgctcggatggggtgaaaacgac
cgaggggtgtctttcacctttggagccgaagtcgttgcaaagttcctacacaaacatgat
ttggaccttatatgcagagctcatcaggtggttgaagatggatatgagttctttgcaaaa
aggcagctggtcaccctgttttctgcccccaattactgcggggagtttgacaacgcaggc
gccatgatgagcgtggatgagactttgatgtgctcctttcagatcttgaagccagccgag
aagaagaagcccaacgctagccgacctgtaacacccccccgggggatgatcacgaaacaa
gcaaagaaataa

DBGET integrated database retrieval system