KEGG   Anolis carolinensis (green anole): 100566078Help
Entry
100566078         CDS       T01608                                 

Gene name
chka
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:acs00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 451 aa AA seqDB search
MKTKFCNGGEADPSPLGLLLGPILPALPPSPSPPLPPSSQAEAEAKQPPPLSVPASLPLL
APTPPSAPAVAEDQQQPEPRTRRKAYLWCKEFLRGAWRGLREDQIRITPIRGGLSNMLFQ
CSLPDTIETVADEPRTVLLRLYGAILQMRSCNKGGSGQAQKENDLQGAEAVVLESVMFAI
LAERALGPKLYGIFPQGRLEEFIPSRKLDTEELSLPDISAEIAEKMARFHGMKMPFNKEP
KWLFGTMEKYLNQVMRIKFTRESRIRKLNKILSYNLPQELKTLRSLLEATSSPVVFCHND
CQEGNILLLEGREDSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYVYEKYPFFKANS
LKYPSRKQQLHFISTYLAASQSGFENLSNEDKSKIEEEMLTEVNRFALASHFFWGLWSII
QAKISSIEFGYMDYALARFDAYFDQKKKLKV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaattctgtaacggcggcgaggccgacccttccccgctggggctgctcttg
ggcccgatcctgcccgctctcccaccgtcgccctcgcctcccttgccgccttcctctcag
gccgaagccgaggccaagcagccgccccccctgtccgtgccggcctctttgccgcttctg
gcgccgacgccgccctccgcgccggcggtggccgaggaccagcagcaacccgagccccgc
acccggcgcaaggcctacctctggtgcaaggagttcctgcggggggcgtggcgggggctg
cgcgaggaccagatccgcatcacgcccatcaggggaggtctaagcaacatgctattccag
tgctcattacctgataccatagagactgttgcagatgaaccacgcactgttcttcttcgt
ttatatggtgcaattctacaaatgaggtcctgtaacaaaggaggatctggacaggctcaa
aaggaaaatgatttacaaggggcagaagcggtagttttggagagtgttatgtttgccatt
cttgctgaaagagctcttggaccaaagctctatggaatctttccacaaggccgtctggag
gaattcattcctagtaggaaactagatactgaagaattaagtctgcctgatatatcagcg
gaaatagctgagaaaatggcaagatttcatgggatgaaaatgccatttaataaagaacct
aagtggctcttcggaactatggagaagtacttaaatcaagtgatgagaatcaagtttacc
agggagtcccgcattaggaaactgaacaagattctcagttacaacctgcctcaagaattg
aaaacactacggtcattactggaagctacttcctctccagttgtgttttgccataatgac
tgtcaagaaggaaatattttgcttctcgaaggtagagaagactcagagaagcaaaagctc
atgcttattgactttgaatacagcagctacaattacagagggtttgatattggaaatcac
ttctgtgaatggatgtacgactatgtctatgaaaaatacccattttttaaagcaaactct
ttgaagtatccatccaggaaacaacagctccatttcatctccacttacctagctgcatct
caaagtgggtttgaaaacctgagcaatgaagataagtcaaaaatagaagaagaaatgcta
acggaagtaaataggtttgcccttgcatcacattttttctggggtctgtggtccattata
caagcaaagatatcctcaattgagtttggatacatggactatgcactcgcacgatttgat
gcctacttcgaccagaagaagaaactcaaagtgtga

DBGET integrated database retrieval system