KEGG   Anolis carolinensis (green anole): 100566152Help
Entry
100566152         CDS       T01608                                 

Gene name
map2k7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Toll-like receptor signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100566152 (map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100566152 (map2k7)
   04012 ErbB signaling pathway
    100566152 (map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100566152 (map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    100566152 (map2k7)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100566152 (map2k7)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100566152 (map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 521 aa AA seqDB search
MKVGKRMRGRCPTRTLVERCRGSSPAHAQEEKLPGKTSAGQSQACEGGGDYGGRVGSGGA
CVVRCLCILAARWRRRLRGRGRGKMAASSLEQKLSRLEAKLKQENREARRRIDLNLEISP
ARARPIIVITLSPAPAPSQRAALQLPLANDGSSRSSSLENSPQHHHPSRPRNMLGLPPQP
QFLMHRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEIGSGTCGQVWKMRF
KKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELM
GTCAEKLKKRIQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKL
CDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQ
FPYKNCKTDFEVLTKVLQEDPPLLPNNMGFSVDFQSFVKDCLTKDHRKRPKYNKLLEHNF
IKRYETLEVDVASWFKDVMAKTESPRTSSILSQHHLPFFTR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgggaaagcgcatgcgcggcagatgtccaacacgtaccctagtagagcgatgt
cgaggttcgagcccagcgcatgcgcaggaggaaaagctgccaggcaaaacaagcgccggg
caaagccaggcttgcgaaggaggaggggattacggcggccgggttggttcaggcggcgcc
tgcgtagttcggtgtttgtgtattctggctgcgcggtggcggcgtcggctccgggggagg
gggagggggaagatggcggcgtcctcgctggagcagaaactgtcccgcctggaagccaag
ctgaagcaagagaacagggaggctcggaggcgcatcgacctcaacttggagatcagtccg
gctcgggctcggcctattattgtgatcactctaagccctgctcccgctccatcccaacgt
gcagccctgcagcttcccttagccaatgatggcagcagccgttcctcctctttggaaaat
tcaccccagcaccaccatccatcacgcccccgaaatatgctgggcttgcctcctcagcca
cagtttctcatgcataggagcatggaaagtatagagattgatcagaaattacaggaaatt
atgaagcaaacaggttacttgaccattggaggacagagataccaagcagaaatcaatgac
ctagaaaatctgggtgagattggaagtgggacttgtggacaggtatggaaaatgcgtttc
aagaagacaggacacatcatagctgtaaagcaaatgcgtcgttctggtaacaaagaagag
aacaagaggatcctaatggacctggatgtagtgctgaagagccatgactgtccttacatt
gttcagtgctttgggactttcatcacaaatactgatgtttttatagccatggagctaatg
gggacttgtgcagagaagctgaaaaaacgcattcagggacctatccctgagaggatctta
ggaaagatgactgtggcgattgtgaaagcactctactatctgaaagagaagcatggtgtc
atccatagagatgtgaagccttccaatatcttattggatgagagggggcaaatcaaactg
tgtgactttgggatcagtgggaggctggtagactcaaaagccaaaacccgaagcgctggt
tgtgcagcatatatggcgcctgagagaatagatccccccgatccttcaaaaccagactat
gatattcgtgcagatgtgtggagcctcggcatctctttggttgagctggctacagggcag
ttcccttacaagaactgcaaaacagattttgaagtccttaccaaggttttgcaggaagat
cctcctcttctcccaaataatatgggattttctgtggatttccagtcatttgtgaaagac
tgccttactaaagatcacaggaagagaccaaagtacaacaaactacttgaacacaacttc
atcaagcgttatgagacactggaagtggatgtggcctcctggttcaaagatgtcatggcg
aagacagagtctccccgcacgagcagcatcctcagccaacatcacctgcccttcttcacc
aggtag

DBGET integrated database retrieval system