KEGG   Anolis carolinensis (green anole): 100566185Help
Entry
100566185         CDS       T01608                                 

Gene name
alpi
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100566185 (alpi)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100566185 (alpi)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100566185 (alpi)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:acs00537]
 Enzymes
  100566185 (alpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 549 aa AA seqDB search
MKAFDNALSCTLNCKTDLEILPFHPIARSQALSTNVAINSLPVFSSFFSVFPVEEEKPDF
WNQQASKAIQNALKLQPRHYQAKNLILFLGDGMGLPTITATRILKGQMQNHLGPETPLTM
DSFPYVALSKTYNVDRQVPDSAGTATAYLCGVKSNYQTIGLNAAARNKQCNTTAGNEVIS
VVKRAQLAGKSVGIVTTTRVQHASPAGTYAHVANRNWYADSSMPESAIKEGCNDISVQLV
ENVNFTVILGGGRMYMSPEGTPDPEYPSNPIHVGIRKDNRSLITEWLKASPGSKYVWNKA
DLLAAGDDPNVSRLMGLFEPKDMQYELKRNNDPSLIEMVEVAIKLLKRNPKGFYLFVEGG
NIDLAHHSGLAKRALTEAVVFDKAIQRAGELTNEDETLSVVTADHSHVFSFGGYTLRGTS
IFGLAPELADDNKTYTSIVYGNGPGYQITEQGRPNVDAEESEGNEYHQQATVPLSSETHG
GEDVAILAKGPMAHLFHGVQEQTYVAHLMAYAACIKPYEDCGLPRFNSASVAKSTPVVLL
LMSLLFWGW
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgacaacgcattgagttgcactctgaattgcaagactgatctcgaaatt
ctccctttccacccgattgcaagatcgcaggctttgtcgacaaatgttgccattaattcc
ctgccagtctttagctctttcttttctgtttttccagttgaagaagagaagccagacttc
tggaaccagcaagcctccaaggccatccaaaacgccttgaaacttcagccgcggcattac
caagcaaagaacctcatcctttttctaggagatggaatgggccttcccaccatcactgcc
acacggatcttgaaaggccagatgcagaaccacctgggtcctgaaacgcctctgactatg
gacagctttccttatgtggctctttctaagacgtacaacgtggaccggcaagtgccagac
agtgccggcacagccaccgcttacctttgtggggtgaagagcaactatcaaaccatcgga
ctgaatgcagctgcacggaataagcaatgcaacacaacagctggcaatgaagtgatttcg
gtggtaaagagggcccagctggccggtaaatctgttgggattgtgaccaccacccgggtc
cagcatgcatcgcctgctgggacctatgctcatgtggcgaaccggaactggtacgcggac
tccagcatgcccgagtctgccatcaaggaaggctgcaatgatatctctgtacaacttgtg
gaaaatgtgaacttcacggtgatcttgggtggaggcaggatgtatatgtccccagaagga
actccggaccctgaatacccctccaacccaattcatgttggcatccgcaaggataaccgt
agcctcataaccgagtggcttaaggcttctccaggctccaaatacgtctggaacaaagca
gaccttttggcagctggggatgacccgaatgtgagccgtctcatgggtctctttgaaccc
aaggacatgcaatatgagctgaaacgcaacaatgacccatctctcatagaaatggtagaa
gttgcaatcaagctgctcaaacgcaaccccaagggtttctacctttttgttgaaggaggt
aacattgaccttgcacaccacagtggcctcgccaagcgtgctctgacggaggcggtagtg
tttgacaaggccatccagcgagcaggagaactgacaaatgaagacgagactctgagcgtg
gtgaccgccgaccactcccacgtcttcagctttggtggctacacgttgaggggcacctcc
atctttggtttagcccctgaactagcagatgacaacaagacatatacatccattgtgtat
gggaatgggccaggctaccagatcactgagcagggacgtcccaatgtggatgcagaagag
agtgagggcaacgaataccaccaacaagccaccgtccccctttcttcggagacccacgga
ggagaagacgtggctatcttggccaagggtccaatggcgcatctcttccacggagttcag
gagcagacatacgttgcccatctcatggcctatgctgcctgcataaaaccatatgaggac
tgcggcctgccacgtttcaactccgcaagtgtcgccaagtccacacctgtggttctcctc
ctcatgtccttgctcttttggggttggtag

DBGET integrated database retrieval system