KEGG   Anolis carolinensis (green anole): 100566304Help
Entry
100566304         CDS       T01608                                 

Definition
histone deacetylase 10-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 594 aa AA seqDB search
MASGTALIYDDEMRNHKLIWDDPICEIEVPERLSSCYEQLQGYNLIERCTSVPVREATED
EIMLVHSSDYLEIVKSTEKMKQEELRKISADFDAVYFHPTTYLCAKLAAGATLELVDAVM
LGRTRNGMALVRPPGHHSQRNAANGFCIFNNVAIAAKYAQKKYGLERILIVDWDVHHGQG
IQYIFDEDPSVLYFSWHRFEHQQFWPSLKESDYDAVGQGKGKGFNINVPWNKVGMGNADY
VAVFLHVLLPLVFEFDPELVLVSAGFDSGIGDPEGQMCATPECFAHLTHFLMHLAKGKLC
LVLEGGYHLRSLSESVCMTIKTLLGDPLPRLSGEMAPCLSALESIHNVRAAHKTYWKCLL
HEGTTPLQDLSTRSHLTGKVEPAQTPQEAKKDEVIETDRFLDQHMKNIASLKSPFRIAVA
LDESDSHLLPPSVQIEKGTDAKELRTTSRKVLLINISAKQLERSNTKYNIFLHWKEKDLE
TTTFISALTGLILPVAYSYQPDLTVVIIGQNQSLSQNGISLLISLLQGLAQSQVLVLIQE
SESKLLQDVIKLLMGDFTPFLGNYTPASKENVQMLTELRQQLQQEWKMLQCSGK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggaacagcactcatttatgatgatgaaatgagaaaccataagctaatttgg
gatgatccgatctgtgagattgaagtacctgagagactctcttcttgctacgagcaactt
cagggttataatctgatcgaaagatgcacatctgtacctgtcagagaagccactgaagat
gagatcatgctggttcacagttcagactacttggaaattgtaaaaagcactgagaaaatg
aagcaagaagaactccggaaaatctctgctgattttgatgctgtttacttccatccaact
acatacctctgtgccaaattggctgccggagccacactggaactggtggatgcagtgatg
ttgggaagaactcgtaacgggatggctttagtaaggcctccgggtcaccacagccagaga
aatgcagccaatgggttctgcatattcaacaatgttgctattgctgcaaaatatgcccaa
aagaaatatggtttggagaggattcttattgttgactgggatgtacatcatggccaagga
attcagtacatatttgatgaagatccaagtgttctctatttttcctggcatcgatttgag
caccagcagttctggccttctctcaaggaatcggattatgatgctgttggacagggaaaa
gggaagggattcaacataaatgtaccttggaataaggtcggaatgggaaatgcggattat
gttgcagtatttcttcatgtattgctcccattggtttttgagtttgatccagagcttgtt
ttggtctctgctggtttcgactctggaattggggatccagagggtcagatgtgtgctaca
cctgaatgttttgcccaccttactcatttcctaatgcatctagcaaaaggaaaattgtgt
ctggttctagagggtggatatcacctgaggtcactctctgaatcggtttgcatgactata
aaaactctgcttggagatccgttgccccgtttgtctggagaaatggcaccatgcttaagt
gcactagaatcaatccataatgtgagagctgcacacaagacatactggaaatgtttgctg
catgaaggcacaactccattgcaagacctcagcaccagatcccatctgacagggaaagta
gagcctgcacaaactccgcaagaggcaaagaaagatgaggtcattgaaacagataggttt
ttggaccagcatatgaaaaatattgcgtccttgaaatcgcctttcagaatagcagtagct
cttgatgaaagtgattcacatttgctaccaccgtctgttcagatcgagaagggaacagat
gcaaaggagctacggaccacaagcagaaaagtgcttttgattaatatctctgctaagcaa
ttggaacgatctaacaccaaatataatatatttctccactggaaggagaaagatcttgaa
acaaccaccttcatctccgctctcactggacttattcttccggtggcatatagctatcag
cctgatctaactgttgtcatcattgggcaaaaccagagcctcagtcaaaatggcatttct
ttacttatcagtttactgcaaggattagcacagtctcaggttcttgttctgattcaggag
tcagaatcaaaactattgcaagatgtaatcaagctattgatgggagactttacacctttt
ttgggaaactacacccctgcttcaaaagagaatgtacaaatgctaacggaattaagacaa
cagcttcagcaggaatggaaaatgctccagtgttcaggcaagtaa

DBGET integrated database retrieval system