KEGG   Anolis carolinensis (green anole): 100566304Help
Entry
100566304         CDS       T01608                                 

Gene name
hdac10
Definition
histone deacetylase 10
Orthology
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100566304 (hdac10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 686 aa AA seqDB search
MASGTALIYDDEMRNHKLIWDDPICEIEVPERLSSCYEQLQGYNLIERCTSVPVREATED
EIMLVHSSDYLEIVKSTEKMKQEELRKISADFDAVYFHPTTYLCAKLAAGATLELVDAVM
LGRTRNGMALVRPPGHHSQRNAANGFCIFNNVAIAAKYAQKKYGLERILIVDWDVHHGQG
IQYIFDEDPSVLYFSWHRFEHQQFWPSLKESDYDAVGQGKGKGFNINVPWNKVGMGNADY
VAVFLHVLLPLVFEFDPELVLVSAGFDSGIGDPEGQMCATPECFAHLTHFLMHLAKGKLC
LVLEGGYHLRSLSESVCMTIKTLLGDPLPRLSGEMAPCLSALESIHNVRAAHKTYWKCLL
HEGTTPLQDLSTRSHLTGKVEPAQTPQEAKKDEVIETDRFLDQHMKNIASLKSPFRIAVA
LDESDSHLLPPSVQIEKGTDAKELRTTSSVFDSKLLKEEKVLKMLAFLEKIIKKEVMLAI
ITICPIFSVTSGLATSPVVSESLAIVLKHCSSLKVQKVLCVFVGDMDMKIDLEDGKVLLI
NISAKQLERSNTKYNIFLHWKEKDLETTTFISALTGLILPVAYSYQPDLTVVIIGQNQSL
SQNGISLLISLLQGLAQSQVLVLIQESESKLLQDVIKLLMGDFTPFLGNYTPASKENVQM
LTELRQQLQQEWKMLQCSAEVSSAEK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggaacagcactcatttatgatgatgaaatgagaaaccataagctaatttgg
gatgatccgatctgtgagattgaagtacctgagagactctcttcttgctacgagcaactt
cagggttataatctgatcgaaagatgcacatctgtacctgtcagagaagccactgaagat
gagatcatgctggttcacagttcagactacttggaaattgtaaaaagcactgagaaaatg
aagcaagaagaactccggaaaatctctgctgattttgatgctgtttacttccatccaact
acatacctctgtgccaaattggctgccggagccacactggaactggtggatgcagtgatg
ttgggaagaactcgtaacgggatggctttagtaaggcctccgggtcaccacagccagaga
aatgcagccaatgggttctgcatattcaacaatgttgctattgctgcaaaatatgcccaa
aagaaatatggtttggagaggattcttattgttgactgggatgtacatcatggccaagga
attcagtacatatttgatgaagatccaagtgttctctatttttcctggcatcgatttgag
caccagcagttctggccttctctcaaggaatcggattatgatgctgttggacagggaaaa
gggaagggattcaacataaatgtaccttggaataaggtcggaatgggaaatgcggattat
gttgcagtatttcttcatgtattgctcccattggtttttgagtttgatccagagcttgtt
ttggtctctgctggtttcgactctggaattggggatccagagggtcagatgtgtgctaca
cctgaatgttttgcccaccttactcatttcctaatgcatctagcaaaaggaaaattgtgt
ctggttctagagggtggatatcacctgaggtcactctctgaatcggtttgcatgactata
aaaactctgcttggagatccgttgccccgtttgtctggagaaatggcaccatgcttaagt
gcactagaatcaatccataatgtgagagctgcacacaagacatactggaaatgtttgctg
catgaaggcacaactccattgcaagacctcagcaccagatcccatctgacagggaaagta
gagcctgcacaaactccgcaagaggcaaagaaagatgaggtcattgaaacagataggttt
ttggaccagcatatgaaaaatattgcgtccttgaaatcgcctttcagaatagcagtagct
cttgatgaaagtgattcacatttgctaccaccgtctgttcagatcgagaagggaacagat
gcaaaggagctacggaccacaagcagcgtatttgattctaaacttctgaaagaggaaaag
gtcttgaagatgttggcttttctggaaaaaataattaaaaaggaggtaatgttggccata
ataactatatgccccatattttccgtgaccagtggccttgcaacatcacctgtagtttcg
gaatccttggctattgttctaaaacactgcagcagcctgaaggtacaaaaggtcctgtgt
gtatttgtcggtgacatggatatgaaaattgacttggaggatggaaaagtgcttttgatt
aatatctctgctaagcaattggaacgatctaacaccaaatataatatatttctccactgg
aaggagaaagatcttgaaacaaccaccttcatctccgctctcactggacttattcttccg
gtggcatatagctatcagcctgatctaactgttgtcatcattgggcaaaaccagagcctc
agtcaaaatggcatttctttacttatcagtttactgcaaggattagcacagtctcaggtt
cttgttctgattcaggagtcagaatcaaaactattgcaagatgtaatcaagctattgatg
ggagactttacaccttttttgggaaactacacccctgcttcaaaagagaatgtacaaatg
ctaacggaattaagacaacagcttcagcaggaatggaaaatgctccagtgttcagcagag
gtttccagtgctgaaaaatga

DBGET integrated database retrieval system