KEGG   Anolis carolinensis (green anole): 100566309Help
Entry
100566309         CDS       T01608                                 

Definition
UDP-glucuronosyltransferase 2A1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100566309
   00053 Ascorbate and aldarate metabolism
    100566309
   00500 Starch and sucrose metabolism
    100566309
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100566309
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100566309
   00860 Porphyrin and chlorophyll metabolism
    100566309
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100566309
   00982 Drug metabolism - cytochrome P450
    100566309
   00983 Drug metabolism - other enzymes
    100566309
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100566309
Glycosyltransferases [BR:acs01003]
 Others
  Hydrophobic molecule
   100566309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 528 aa AA seqDB search
MSVKWMLVFPIATACFVGSSSAGKVLVWPVDNSHWINMKFILNELTDRGHQVTVLLPSFF
MAVKASEPSPFQLEEIPFLFSREDMDTMLQDFLFMWSYESNELSFWQFFIKTHDFSREME
RRNRILCDRVVLNQTLMERLESVGFDILIADPLLPCGELVAEKLHLPFVYTFRFSVGNTM
ECVCGVIPAPPSFVPASLGGLTDRMSFMQRTRNMLFYALHDILFHQVLWKDWSKYYSDVL
GRPTTLCETMGKAEIWLIRTYWDFEFPRPLLPNFEFVGGLHCQPAKPLPKEMEEFVQSSG
EHGIVVFSLGSMLKNLTDEKSNLVALALSQLPQKVIWRYKGKRPETLGANTRLYDWIPQN
DLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPMFADQPDNIAHMRAKGMAVELNMYTM
TAQDLLDAVNTVIHNTTYKENAVRLSKIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWYQYHCLDVIAFLISCVALFMFIIVKCCSFCCRKCGITRKTKIE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggatgctggtgtttcctattgcaacggcatgcttcgtgggctcatct
tctgctgggaaggtccttgtctggccagttgacaacagtcattggatcaacatgaaattt
attttgaatgaactcacagacagaggccaccaagtgacagttctactaccttccttcttc
atggcagttaaggcaagcgagccttccccctttcagctggaagagatcccttttttattc
tcaagggaagacatggatactatgcttcaggacttcctctttatgtggtcttatgagtcc
aatgaactttctttctggcagtttttcatcaagacacatgacttttcaagggagatggag
cgcaggaacagaattctctgcgatagggttgtcttgaaccagacattgatggaaaggtta
gagtctgttggttttgacatcctcattgcagacccactcttgccttgtggagagctagtg
gctgagaagcttcaccttccgtttgtgtacacttttcgattctcagttggaaatacaatg
gagtgtgtttgcggtgtcatcccagctcctccatcatttgtacctgccagtcttggaggt
ctaaccgataggatgtccttcatgcagagaacaagaaacatgctcttttatgccttacat
gacattttgtttcatcaagttctctggaaagactggagtaaatactatagtgatgttcta
gggagacctacaacattgtgcgaaacaatgggcaaggcagaaatatggctgatccgaacc
tactgggactttgaatttccacggccattactaccaaattttgaatttgtaggagggctg
cattgccagccagcaaagcctttgcctaaggaaatggaagaatttgtccagagttccgga
gaacatggcattgtggtattttctctcggttcaatgcttaaaaacctaacagatgaaaaa
agcaacctggttgccctggcactcagccagcttccgcagaaggttatttggcggtacaaa
gggaaaaggccagaaacattaggagccaataccagactttatgactggatcccacaaaat
gatctactgggacatcccaagacaaaagcttttataactcatggtggaaccaatgggatc
tatgaagccatttatcatggtattcccatggtagggatccccatgtttgcagaccaacct
gataacattgctcacatgcgtgcaaagggaatggctgtagagctgaatatgtacacaatg
actgcacaagatttattggatgccgttaataccgttattcacaatacaacatataaggaa
aatgcagtacgtctgtcgaagattcatcatgatcaacctatgaagcctctagaccgagct
gtcttctggattgagtttgttatgcgccacaaaggtgccaaacatttgagagtagctgcc
catgacttgacctggtaccagtatcactgccttgatgtcattgcctttttgatcagttgt
gtggcacttttcatgttcatcattgtaaaatgctgctcgttttgctgtcggaaatgtggc
atcacacggaaaacaaaaattgaatag

DBGET integrated database retrieval system