KEGG   Anolis carolinensis (green anole): 100566341Help
Entry
100566341         CDS       T01608                                 

Definition
histone deacetylase 2-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:acs04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:acs04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDAEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNIADHKKSAKKARLEEDKKETEDKKADIKEEDKSKDSSGEKADTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcatacagtcagggaggcggcaagaagaaagtctgctactattatgacggtgatatt
gggaactattattatgggcagggacacccgatgaaaccccacaggattcgcatgactcac
aacttgctgctgaactatggcttgtatagaaaaatggaaatctatcgaccccacaaagct
acagcagaggaaatgacgaaataccacagtgatgagtacatcaaatttcttcgctcaata
agacctgataatatgtctgagtatagcaaacagatgcaaagatttaatgttggggaagat
tgtcctgtgtttgatggactgtttgagttctgtcagctgtcaactggaggttctgttgct
ggagcagtaaaattaaacagacaacagacagacatggctgtcaattgggctggaggactt
catcatgcaaagaagtctgaggcatctggtttctgttacgtgaatgatattgtgcttgct
attcttgaattactgaagtaccaccaaagagtgctctacattgatattgatatccatcat
ggtgatggtgttgaagaagcattttatacaacagatcgtgttatgactgtatcattccat
aaatatggtgaatatttccctggtacaggggatttaagggacataggtgccggcaaaggg
aaatattatgctgtcaattttccaatgagagatggaatagacgatgaatcatatggacag
atatttaagccaatcatatccaaagtcatggagatgtatcagcctagtgctgtggtgctg
cagtgtggggcggattcactatctggtgacaggcttggatgttttaatcttactgtcaaa
ggtcatgctaaatgtgtggaagttgtaaagaccttcaacttgcctcttctgatgcttgga
ggaggtggatataccattcgtaatgttgctcggtgctggacctacgagactgctgttgcc
ttagactgtgaaattcctaatgaattgccatacaatgactacttcgaatattttggacca
gatttcaagctacatattagcccatcaaatatgacaaatcagaacacccccgaatatatg
gaaaagattaaacaacgtttatttgagaacttgcgcatgttaccccatgctcctggtgta
cagatgcaggctattcctgaagatgctgttcatgaagacagtggggatgaagatgctgaa
gatccagacaaacgtatttctattcgtgcttctgataagcgtatagcctgtgatgaagaa
ttttctgattctgaagatgaaggtgaaggtggacgcagaaacattgcagatcacaagaaa
agtgcaaagaaggctcgattagaagaagataaaaaagagacagaagacaaaaaagcagat
attaaagaggaagataaatccaaggatagcagtggtgaaaaggctgataccaaaggcacg
aagtcggaacagctcagcaatccttga

DBGET integrated database retrieval system