KEGG   Anolis carolinensis (green anole): 100566372Help
Entry
100566372         CDS       T01608                                 

Definition
glutamate receptor, ionotropic kainate 4-like
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:acs04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A
AA seq 959 aa AA seqDB search
MPRILAPLVLLLLWLMKITASPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERMG
KARVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFLKLQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLERLLR
QFLISKETLSVRMLDDSRDPTPLLKEIRDDKTATIIVHANASMSHIILNKAAELGMVSAY
YTYIFTNLEFSLQRLDSLLDDRVNIMAFSIFNQSHAFFQEFAESLNQSWLENCDHIPFTG
PALSSALLFDAVYAVVNAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQYTRNGFRQIGHWHVTKGLTMDNQVFSSNVTESLFNTTLIV
TTILENPYLMLKGNHPELEGNDRYEGFCVDMLKELAEILHFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCSQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQVGGLLDTKGYGIGMPVGSLFRDEFDLAILQLQENNRLEILK
RKWWEGGQCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWNLRHSEHSEVS
VCQEMVTELRSIILCKDSFQPRRRRGGIIRTRPIIQEERRARTTTTLSNGKLCGGGDPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRLRAGPDSPMQSDESLEWEKVTNSSEPE
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcatcttggcgcctctggtgctccttttgctgtggctgatgaagatcaccgcc
agtccccactctctgagaattgctgccatattggatgacccaatggagtgtagtagaggc
gaaaggctgtccatcacgttggccaaaaaccggatcaatcgggctccagagcggatggga
aaggccagagtggaggtggacatctttgagcttttgagagacagcgaatatgagacagcc
gagaccatgtgccaaatccttcccaaaggagtggtggctgtcctgggaccgtcttcaagt
ccagcttccagctctatcatcagcaatatttgtggggagaaagaggtccctcatttcaag
gttgccccagaagaattcctcaagctgcagctccagagattcacaaccttgaacctccat
cccagcaacacggacatcagcgtggccgtggccgggatcctgaatttcttcaactgcacc
actgcctgcctcatctgtgccaaagctgaatgccttctaaacctggagagattgctccgt
cagttccttatctctaaggaaaccctctcggtccggatgttggatgacagccgggacccg
acaccgttgttaaaggagatcagggatgataagacggccaccattatcgtccacgccaac
gcttcaatgtcccacatcatcctcaacaaggcagccgaactgggaatggtgtccgcctat
tacacatatatcttcactaatctggagttttcccttcaacgactggacagccttctggat
gaccgggtgaacatcatggcgttttctattttcaaccagtcccatgctttcttccaagag
tttgcggagagcctcaaccagtcctggctggagaactgtgaccacatccctttcactgga
cccgccttgtcttctgccttgttgtttgatgctgtctatgctgtggtgaatgcggtgcaa
gaactcaaccggagccaggaaatcggcgtgaaacccttgtcctgtgggtccgcccaaatc
tggcagcatggcaccagcttgatgaactatctaagaatggtagaattggaaggtctcacc
ggccacatagagttcaacagcaaaggccagcggtccaactatgccctgaaaatcctgcag
tatacgaggaacggcttccgacagatcggtcactggcatgttaccaaaggccttaccatg
gacaaccaggtcttctcctccaacgtcacggagagcctcttcaacaccacactcattgtc
accactatcctggaaaacccctacttaatgctgaagggcaaccatccggagctggaaggg
aatgaccgctacgaaggcttctgcgtggacatgctgaaggagctggcggagatcctgcat
ttcaactacaagatccgtctggttggcgacggagtgtacggagtccccgaggccaacggg
acctggaccgggatggtgggagagctgatcgctcggaaagctgatttggcagtagctgga
ttgacgattaccgccgagcgggagaaagtgatcgatttctccaagccgttcatgactctg
gggattagcatcctctaccgagttcacatgggccgcaagcctggctacttctctttcctg
gatcctttttctcctggcgtctggctcttcatgttacttgcctacctcgctgtgagctgt
gtcctcttcttggtggcccgactgacaccctacgagtggtacagcccacacccctgctcc
caagggaggtgcaacctgctagtaaatcagtactctcttgggaacagcttgtggttccct
gtgggtggattcatgcagcaagggtccaccattgctcctcgggctctctccacacgctgc
gtcagcggagtctggtgggccttcaccttgatcatcatctcatcctacacggccaacctg
gcagcctttctcaccgtacagcgcatggatgtgcccattgaatcagtcgatgaccttgct
gaccagacggctattgaatatggcacaatccatggcggttccagcatgaccttcttccag
aattcccggtaccagacgtaccagcgaatgtggaattacatgtattcaaagcagcctagc
gtctttgtcaagagcacagaggaagggattgcacgggtgctcaactccaactatgccttc
ctgctggagtcgaccatgaacgagtattaccgccagcgcaattgcaacctcacgcaggtc
gggggccttctggacaccaagggctacgggattggcatgccagtcggttcgctttttcgg
gatgagtttgacttggccattcttcagctgcaggagaacaaccgcctggaaatcttgaag
cgaaagtggtgggagggagggcagtgccccaaagaagaggaccaccgagcgaaaggcctg
ggaatggaaaatataggtggaatctttgtggttctgatatgtggtttaatcgtagcgatt
tttatggcaatgctggagtttttatggaacctccgacactctgaacactccgaggtgtct
gtgtgccaggagatggtgacagagttgcgtagcatcattctctgcaaggacagtttccaa
ccccgtcggaggcgaggggggattatacggactcgccccattatacaggaagaacggaga
gcccgcaccaccaccacactcagcaatggcaaactctgcggtggaggagaccccgatcag
cttgcacagagacttgcacaagaagccgccctggttgctcgtggctgcacgcacatccga
gtatgtccggaatgccggaggttccaaggtctccggcttcgggcaggaccagattctccc
atgcaaagtgatgagagcttggaatgggagaaggttacaaacagcagtgaaccggagtaa

DBGET integrated database retrieval system