KEGG   Anolis carolinensis (green anole): 100566496Help
Entry
100566496         CDS       T01608                                 

Gene name
itgb8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100566496 (itgb8)
   04514 Cell adhesion molecules (CAMs)
    100566496 (itgb8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100566496 (itgb8)
  Cellular commiunity
   04510 Focal adhesion
    100566496 (itgb8)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100566496 (itgb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 739 aa AA seqDB search
MWLPLLSALSLGLVSPGWAQAPDNRCATSHATTCATCLALGPECGWCSQEEFMTGTRRKE
RCDKVLHLIKRGCREDFIESPKDDIKVSSNEVHIQVTPGEVSIHLYPGSEASFMLKVHPL
EKYPVDLYYLVDVSASMHKNIEKLNSVGFDLSQKMKNISVDLRLGFGSYVDKTVSPYISI
HPGRIHNQCSDYDLDCMPPHGYIHVLSLTDQIAEFGRAINKQKISGNIDTPEGGFDAMLQ
AAVCQSQIGWRKEAKRLLLMMTDQTSHLALDSKLGGIVIPNDGNCHLKDNVYTKATSMEH
PSLGQLAEKLIDNNISVIFAVQGSQYHWYKDLLSLLPGTVARQIESQAANLGDLVVDAYK
NLLSEVKIQVDNTDQDINVKVTAICPDGSRKTGLEGCRNVKSTTEVSFNVTITMKKCGTT
EGRKYIMIKPLGFNESTRVNIHKRCACQCEGKRICVDEMSPDSQTSHCKDGICDSSDEFS
SEQCKMKGDHLICSGQGECVGGKCICYKTKLGTVYGEYCEKDDFSCPYYLGNLCAGNGEC
EAGKCKCIGPWEGDRCQCSLSLKKNCMNSDGQICSGRGTCVCGRCKCTDPSSFGHLCEFC
PACRTICNDRRTCVPCHSNSSQITLDQCKTSCAYRVHHTEQSLGCISDDPSHFRIFFIIF
IVTFLIGLLNVLIIRQIFLQWNNNKIKSSADYRVAAAKKEKMFLPTVCTKTVTYRRDNPE
EISIHLSKLQVNETFCCNS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccgctcctgtccgccttgtcgctgggactggtctcgccgggatgggcacaa
gcgccagacaacagatgtgccacttcacatgcaacaacatgtgccacatgccttgctctg
ggcccagaatgtggatggtgcagtcaagaggagtttatgactggaacaaggcggaaggaa
cgatgtgacaaagttctccatttaataaaaaggggctgcagggaggattttatagaaagt
cccaaagatgatataaaagtatccagcaatgaagttcatatacaagtgacaccaggagaa
gtgtccattcacctctatccaggatctgaagcaagttttatgttgaaagtccacccactg
gaaaagtaccccgtggacctctattatttagttgatgtgtctgcatcaatgcacaaaaac
atagaaaaattaaactctgttggatttgatttatctcaaaagatgaaaaatatttctgtt
gatttacggcttggatttggatcctatgtggataagacagtgtcaccttatattagtatt
catccaggcagaatccacaatcagtgcagtgattatgatctagattgcatgcctccacat
ggttatatccatgtcttatcactgacagaccaaatagcagaatttgggcgtgcaatcaat
aagcaaaagatctctggaaatattgacacacctgaaggaggatttgatgctatgcttcag
gctgctgtgtgccagagccagattggttggcgcaaagaagcaaaacgtctactcctcatg
atgacagatcagacctctcatctggctcttgacagtaaattaggaggaatagtaattcct
aatgatggaaattgccatttaaaagataacgtgtacaccaaagcaaccagtatggagcat
ccatcactcggtcaacttgctgaaaagctcatagacaacaatattagtgtaatctttgca
gtccaaggaagccaatatcattggtataaggaccttttgtctctgctgcctggcactgtt
gcaagacagatagaatcacaagcagcaaatctgggagatctggtggtagatgcttacaag
aatctgctttctgaagtgaaaattcaggtggataacacagaccaagacataaatgtcaaa
gttactgcaatctgtcctgatgggagtagaaaaacaggcttagaaggatgcagaaatgtg
aaatccacaactgaagtatcctttaatgtcaccattacaatgaagaaatgtggaaccact
gaaggaagaaaatacataatgataaaaccccttggtttcaatgaatctaccagggttaat
atacataaaagatgtgcttgtcagtgtgagggtaaaagaatatgtgtggatgaaatgtct
ccggattcccaaacttcccactgcaaggatggtatctgtgattccagtgatgaattctct
tcagagcaatgcaaaatgaaaggggaccatctaatctgtagtggccaaggagagtgtgta
ggtgggaaatgcatttgctacaaaaccaaactcggcacagtatatggtgaatattgtgaa
aaggatgatttttcctgcccatattaccttggaaacctgtgtgctggcaatggtgaatgt
gaagctggaaaatgcaaatgcattggtccctgggaaggtgatcgctgccaatgttcatta
tcattgaaaaaaaactgcatgaattcagatggtcagatctgcagcggaagaggaacttgt
gtgtgtggaagatgcaaatgcactgatcccagcagttttggccatctatgtgaattctgc
cctgcttgcagaacaatttgcaatgacaggcggacttgtgtgccatgtcattccaactca
tctcaaattacacttgaccagtgcaaaacctcatgtgcttacagggtgcatcatacagaa
caatctttaggctgcatctctgatgatccaagccacttcagaatctttttcataatcttc
attgtgacctttctgattggcttgctgaatgtgcttataattcgtcagatctttctgcag
tggaacaataataaaattaagtcttctgctgattacagagtggctgcagcaaaaaaggag
aaaatgttcctacctactgtttgtacaaaaacagtaacctacagacgcgacaaccctgaa
gaaataagcatccacctcagcaagttacaagtaaatgaaactttctgttgcaactcctga

DBGET integrated database retrieval system