KEGG   Anolis carolinensis (green anole): 100566496Help
Entry
100566496         CDS       T01608                                 

Gene name
itgb8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  integrin beta 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04510  Focal adhesion
acs04512  ECM-receptor interaction
acs04514  Cell adhesion molecules (CAMs)
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100566496 (itgb8)
   04514 Cell adhesion molecules (CAMs)
    100566496 (itgb8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100566496 (itgb8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100566496 (itgb8)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100566496 (itgb8)
Cell adhesion molecules [BR:acs04515]
 Integrins
  Integrin beta subunits
   100566496 (itgb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 100566496
NCBI-ProteinID: XP_003222192
Ensembl: ENSACAG00000011506
UniProt: G1KLF7
Position
6
AA seq 739 aa AA seqDB search
MWLPLLSALSLGLVSPGWAQAPDNRCATSHATTCATCLALGPECGWCSQEEFMTGTRRKE
RCDKVLHLIKRGCREDFIESPKDDIKVSSNEVHIQVTPGEVSIHLYPGSEASFMLKVHPL
EKYPVDLYYLVDVSASMHKNIEKLNSVGFDLSQKMKNISVDLRLGFGSYVDKTVSPYISI
HPGRIHNQCSDYDLDCMPPHGYIHVLSLTDQIAEFGRAINKQKISGNIDTPEGGFDAMLQ
AAVCQSQIGWRKEAKRLLLMMTDQTSHLALDSKLGGIVIPNDGNCHLKDNVYTKATSMEH
PSLGQLAEKLIDNNISVIFAVQGSQYHWYKDLLSLLPGTVARQIESQAANLGDLVVDAYK
NLLSEVKIQVDNTDQDINVKVTAICPDGSRKTGLEGCRNVKSTTEVSFNVTITMKKCGTT
EGRKYIMIKPLGFNESTRVNIHKRCACQCEGKRICVDEMSPDSQTSHCKDGICDSSDEFS
SEQCKMKGDHLICSGQGECVGGKCICYKTKLGTVYGEYCEKDDFSCPYYLGNLCAGNGEC
EAGKCKCIGPWEGDRCQCSLSLKKNCMNSDGQICSGRGTCVCGRCKCTDPSSFGHLCEFC
PACRTICNDRRTCVPCHSNSSQITLDQCKTSCAYRVHHTEQSLGCISDDPSHFRIFFIIF
IVTFLIGLLNVLIIRQIFLQWNNNKIKSSADYRVAAAKKEKMFLPTVCTKTVTYRRDNPE
EISIHLSKLQVNETFCCNS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccgctcctgtccgccttgtcgctgggactggtctcgccgggatgggcacaa
gcgccagacaacagatgtgccacttcacatgcaacaacatgtgccacatgccttgctctg
ggcccagaatgtggatggtgcagtcaagaggagtttatgactggaacaaggcggaaggaa
cgatgtgacaaagttctccatttaataaaaaggggctgcagggaggattttatagaaagt
cccaaagatgatataaaagtatccagcaatgaagttcatatacaagtgacaccaggagaa
gtgtccattcacctctatccaggatctgaagcaagttttatgttgaaagtccacccactg
gaaaagtaccccgtggacctctattatttagttgatgtgtctgcatcaatgcacaaaaac
atagaaaaattaaactctgttggatttgatttatctcaaaagatgaaaaatatttctgtt
gatttacggcttggatttggatcctatgtggataagacagtgtcaccttatattagtatt
catccaggcagaatccacaatcagtgcagtgattatgatctagattgcatgcctccacat
ggttatatccatgtcttatcactgacagaccaaatagcagaatttgggcgtgcaatcaat
aagcaaaagatctctggaaatattgacacacctgaaggaggatttgatgctatgcttcag
gctgctgtgtgccagagccagattggttggcgcaaagaagcaaaacgtctactcctcatg
atgacagatcagacctctcatctggctcttgacagtaaattaggaggaatagtaattcct
aatgatggaaattgccatttaaaagataacgtgtacaccaaagcaaccagtatggagcat
ccatcactcggtcaacttgctgaaaagctcatagacaacaatattagtgtaatctttgca
gtccaaggaagccaatatcattggtataaggaccttttgtctctgctgcctggcactgtt
gcaagacagatagaatcacaagcagcaaatctgggagatctggtggtagatgcttacaag
aatctgctttctgaagtgaaaattcaggtggataacacagaccaagacataaatgtcaaa
gttactgcaatctgtcctgatgggagtagaaaaacaggcttagaaggatgcagaaatgtg
aaatccacaactgaagtatcctttaatgtcaccattacaatgaagaaatgtggaaccact
gaaggaagaaaatacataatgataaaaccccttggtttcaatgaatctaccagggttaat
atacataaaagatgtgcttgtcagtgtgagggtaaaagaatatgtgtggatgaaatgtct
ccggattcccaaacttcccactgcaaggatggtatctgtgattccagtgatgaattctct
tcagagcaatgcaaaatgaaaggggaccatctaatctgtagtggccaaggagagtgtgta
ggtgggaaatgcatttgctacaaaaccaaactcggcacagtatatggtgaatattgtgaa
aaggatgatttttcctgcccatattaccttggaaacctgtgtgctggcaatggtgaatgt
gaagctggaaaatgcaaatgcattggtccctgggaaggtgatcgctgccaatgttcatta
tcattgaaaaaaaactgcatgaattcagatggtcagatctgcagcggaagaggaacttgt
gtgtgtggaagatgcaaatgcactgatcccagcagttttggccatctatgtgaattctgc
cctgcttgcagaacaatttgcaatgacaggcggacttgtgtgccatgtcattccaactca
tctcaaattacacttgaccagtgcaaaacctcatgtgcttacagggtgcatcatacagaa
caatctttaggctgcatctctgatgatccaagccacttcagaatctttttcataatcttc
attgtgacctttctgattggcttgctgaatgtgcttataattcgtcagatctttctgcag
tggaacaataataaaattaagtcttctgctgattacagagtggctgcagcaaaaaaggag
aaaatgttcctacctactgtttgtacaaaaacagtaacctacagacgcgacaaccctgaa
gaaataagcatccacctcagcaagttacaagtaaatgaaactttctgttgcaactcctga

DBGET integrated database retrieval system