KEGG   Anolis carolinensis (green anole): 100566496Help
Entry
100566496         CDS       T01608                                 

Gene name
itgb8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:acs04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:acs04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 739 aa AA seqDB search
MWLPLLSALSLGLVSPGWAQAPDNRCATSHATTCATCLALGPECGWCSQEEFMTGTRRKE
RCDKVLHLIKRGCREDFIESPKDDIKVSSNEVHIQVTPGEVSIHLYPGSEASFMLKVHPL
EKYPVDLYYLVDVSASMHKNIEKLNSVGFDLSQKMKNISVDLRLGFGSYVDKTVSPYISI
HPGRIHNQCSDYDLDCMPPHGYIHVLSLTDQIAEFGRAINKQKISGNIDTPEGGFDAMLQ
AAVCQSQIGWRKEAKRLLLMMTDQTSHLALDSKLGGIVIPNDGNCHLKDNVYTKATSMEH
PSLGQLAEKLIDNNISVIFAVQGSQYHWYKDLLSLLPGTVARQIESQAANLGDLVVDAYK
NLLSEVKIQVDNTDQDINVKVTAICPDGSRKTGLEGCRNVKSTTEVSFNVTITMKKCGTT
EGRKYIMIKPLGFNESTRVNIHKRCACQCEGKRICVDEMSPDSQTSHCKDGICDSSDEFS
SEQCKMKGDHLICSGQGECVGGKCICYKTKLGTVYGEYCEKDDFSCPYYLGNLCAGNGEC
EAGKCKCIGPWEGDRCQCSLSLKKNCMNSDGQICSGRGTCVCGRCKCTDPSSFGHLCEFC
PACRTICNDRRTCVPCHSNSSQITLDQCKTSCAYRVHHTEQSLGCISDDPSHFRIFFIIF
IVTFLIGLLNVLIIRQIFLQWNNNKIKSSADYRVAAAKKEKMFLPTVCTKTVTYRRDNPE
EISIHLSKLQVNETFCCNS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccgctcctgtccgccttgtcgctgggactggtctcgccgggatgggcacaa
gcgccagacaacagatgtgccacttcacatgcaacaacatgtgccacatgccttgctctg
ggcccagaatgtggatggtgcagtcaagaggagtttatgactggaacaaggcggaaggaa
cgatgtgacaaagttctccatttaataaaaaggggctgcagggaggattttatagaaagt
cccaaagatgatataaaagtatccagcaatgaagttcatatacaagtgacaccaggagaa
gtgtccattcacctctatccaggatctgaagcaagttttatgttgaaagtccacccactg
gaaaagtaccccgtggacctctattatttagttgatgtgtctgcatcaatgcacaaaaac
atagaaaaattaaactctgttggatttgatttatctcaaaagatgaaaaatatttctgtt
gatttacggcttggatttggatcctatgtggataagacagtgtcaccttatattagtatt
catccaggcagaatccacaatcagtgcagtgattatgatctagattgcatgcctccacat
ggttatatccatgtcttatcactgacagaccaaatagcagaatttgggcgtgcaatcaat
aagcaaaagatctctggaaatattgacacacctgaaggaggatttgatgctatgcttcag
gctgctgtgtgccagagccagattggttggcgcaaagaagcaaaacgtctactcctcatg
atgacagatcagacctctcatctggctcttgacagtaaattaggaggaatagtaattcct
aatgatggaaattgccatttaaaagataacgtgtacaccaaagcaaccagtatggagcat
ccatcactcggtcaacttgctgaaaagctcatagacaacaatattagtgtaatctttgca
gtccaaggaagccaatatcattggtataaggaccttttgtctctgctgcctggcactgtt
gcaagacagatagaatcacaagcagcaaatctgggagatctggtggtagatgcttacaag
aatctgctttctgaagtgaaaattcaggtggataacacagaccaagacataaatgtcaaa
gttactgcaatctgtcctgatgggagtagaaaaacaggcttagaaggatgcagaaatgtg
aaatccacaactgaagtatcctttaatgtcaccattacaatgaagaaatgtggaaccact
gaaggaagaaaatacataatgataaaaccccttggtttcaatgaatctaccagggttaat
atacataaaagatgtgcttgtcagtgtgagggtaaaagaatatgtgtggatgaaatgtct
ccggattcccaaacttcccactgcaaggatggtatctgtgattccagtgatgaattctct
tcagagcaatgcaaaatgaaaggggaccatctaatctgtagtggccaaggagagtgtgta
ggtgggaaatgcatttgctacaaaaccaaactcggcacagtatatggtgaatattgtgaa
aaggatgatttttcctgcccatattaccttggaaacctgtgtgctggcaatggtgaatgt
gaagctggaaaatgcaaatgcattggtccctgggaaggtgatcgctgccaatgttcatta
tcattgaaaaaaaactgcatgaattcagatggtcagatctgcagcggaagaggaacttgt
gtgtgtggaagatgcaaatgcactgatcccagcagttttggccatctatgtgaattctgc
cctgcttgcagaacaatttgcaatgacaggcggacttgtgtgccatgtcattccaactca
tctcaaattacacttgaccagtgcaaaacctcatgtgcttacagggtgcatcatacagaa
caatctttaggctgcatctctgatgatccaagccacttcagaatctttttcataatcttc
attgtgacctttctgattggcttgctgaatgtgcttataattcgtcagatctttctgcag
tggaacaataataaaattaagtcttctgctgattacagagtggctgcagcaaaaaaggag
aaaatgttcctacctactgtttgtacaaaaacagtaacctacagacgcgacaaccctgaa
gaaataagcatccacctcagcaagttacaagtaaatgaaactttctgttgcaactcctga

DBGET integrated database retrieval system