KEGG   Anolis carolinensis (green anole): 100566505Help
Entry
100566505         CDS       T01608                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 225 aa AA seqDB search
MEAIVTGRTLEMDRTLENGIIKSDKVFEVMLATDRCHYAKCNPYMDSPQSIGFQATISAP
HMHAYALELLYEQLHEGAKALDVGSGSGILTACFARMVGPKGKVVGIDHIKELVDDSINN
VRKDDPLLLSSGRVKLIVGDGRLGCPDEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaattgtcactgggcggacgttggagatggatcgaacgctggaaaatggaata
ataaaatccgacaaagtattcgaagtgatgcttgcaacagaccgttgccattatgcaaaa
tgtaacccgtatatggattctcctcaatcaataggatttcaagcaacaatcagtgctcca
cacatgcatgcatatgctttagaactcctatatgaacagttacatgaaggcgccaaagct
cttgatgtaggatctggaagtggtattcttactgcatgctttgcacggatggttggtccc
aaaggaaaagttgtaggaattgatcatatcaaagaactagtagatgattcaataaataat
gttagaaaggatgatcctctgttgctatcttcaggtagagtgaaactgattgtgggagat
ggaaggctgggctgtccagatgaagcaccatatgatgctatccatgtaggagctgctgca
ccagttgtgccacaagcacttatagatcagttaaagcctggtggaaggttaatattacct
gttggccctgctggaggaaaccagatgctggaacagtatgataagctagaagatggcagt
gtcaaaatgaagcctctgatgggagtgatatatgtgcctttaacagataaggaaaagcag
tggtccaggtggaagtga

DBGET integrated database retrieval system