KEGG   Anolis carolinensis (green anole): 100566505Help
Entry
100566505         CDS       T01608                                 

Gene name
pcmt1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100566505 (pcmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 300 aa AA seqDB search
MWSARGDEGAAPPSGGRAAVTAAAARRGGRAAAAEEEAAPVSALEVVSFLGKLLCAVAAL
KAALYLLRRICLAMAWKSGGASHSELIHNLRKNGIIKSDKVFEVMLATDRCHYAKCNPYM
DSPQSIGFQATISAPHMHAYALELLYEQLHEGAKALDVGSGSGILTACFARMVGPKGKVV
GIDHIKELVDDSINNVRKDDPLLLSSGRVKLIVGDGRLGCPDEAPYDAIHVGAAAPVVPQ
ALIDQLKPGGRLILPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcgcgcggggggacgagggagcggcccctccctccggcgggcgcgcggcggta
acagcagcagcggcgaggaggggagggagggcggcggcggcggaggaggaggcggcgcct
gtctcggcgctggaggttgtgtccttcctgggcaagctcctgtgcgcagtcgcggcgctg
aaggcggctctctacctgctccgcagaatctgcctcgccatggcctggaagtcaggaggc
gccagccactccgagctcatccacaacctccgcaaaaatggaataataaaatccgacaaa
gtattcgaagtgatgcttgcaacagaccgttgccattatgcaaaatgtaacccgtatatg
gattctcctcaatcaataggatttcaagcaacaatcagtgctccacacatgcatgcatat
gctttagaactcctatatgaacagttacatgaaggcgccaaagctcttgatgtaggatct
ggaagtggtattcttactgcatgctttgcacggatggttggtcccaaaggaaaagttgta
ggaattgatcatatcaaagaactagtagatgattcaataaataatgttagaaaggatgat
cctctgttgctatcttcaggtagagtgaaactgattgtgggagatggaaggctgggctgt
ccagatgaagcaccatatgatgctatccatgtaggagctgctgcaccagttgtgccacaa
gcacttatagatcagttaaagcctggtggaaggttaatattacctgttggccctgctgga
ggaaaccagatgctggaacagtatgataagctagaagatggcagtgtcaaaatgaagcct
ctgatgggagtgatatatgtgcctttaacagataaggaaaagcagtggtccaggtggaag
tga

DBGET integrated database retrieval system