KEGG   Anolis carolinensis (green anole): 100566527Help
Entry
100566527         CDS       T01608                                 

Definition
guanidinoacetate N-methyltransferase-like
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100566527
   00330 Arginine and proline metabolism
    100566527
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100566527
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 155 aa AA seqDB search
MASTAGLAAPIFREGEDCKASWKAAGAGYDATDTHLEILGKPVMERWETPYMHSLATVAA
SKGGRVLEVGFGMAIAATKIETFDIEEHWIIECNEGVFQRLQEWAKTQPHKVVLLKGLWE
DVVPTLPSEHFDGILYDTYPLSAETWHTHQFGFIK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccgctggactcgccgctccgatcttccgggaaggagaggactgcaaggct
tcgtggaaagcggccggcgccggctacgatgccacggacacccacttggagatcctgggg
aagccggtcatggagcgctgggagaccccttacatgcactccctggccacggtggccgct
tcgaaaggcggccgggtcttggaggtgggcttcggcatggccatcgccgccaccaaaatc
gagacgtttgatatcgaggagcactggatcatcgagtgcaacgaaggggtctttcagcgg
ctccaggaatgggccaaaacccagcctcacaaggtcgtcctgctgaaagggttgtgggaa
gacgttgtcccgactttgccctccgaacactttgatggaatcctttacgacacgtacccg
ctttcggcagagacctggcacactcaccagtttggcttcatcaag

DBGET integrated database retrieval system