KEGG   Anolis carolinensis (green anole): 100566538Help
Entry
100566538         CDS       T01608                                 

Gene name
clk4
Definition
CDC-like kinase 4
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100566538 (clk4)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100566538 (clk4)
Spliceosome [BR:acs03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100566538 (clk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 477 aa AA seqDB search
MMHSELSHCSEKNNRRNSNEEKSTNSHKRKRQSHSSERHDKHYKSLKSADRYFSDRSSHR
RDHHDRRYVEEYRNDFNDTDDQKPYNRDYEKSHCHHYSKSHQNSKSHKRKHKKHDSTYSS
HLKSHRRKRSRSVEDDEEGHLVCQNGDVLRARYEIIATLGEGAFGKVVECIDHHMRAVHV
AIKIVKNVGRYREAARSEIQVLEHLNTLDPSSTFRCVQMLEWFEHHGHMCIVFELLGLST
YDFIKENSFLPFPIELIRKMAYQICQSINFLHHNKLTHTDLKPENILFVESDYIVKYNSQ
MRRDERTLKNTDIKVVDFGSATYDNEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCI
LIEYYLGFTVFQTHDSKEHLAMMQRILGPLPVHMIKKSRKRYFHKNELDWDEHSHAARYV
RKRCKPLKEFMHCHDKDHENLFDLLRKMLEYDPVKRITLDEALEHPFFDPLKERELS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgcactcagaactatcccactgctctgaaaagaataatagaagaaactcgaacgaa
gaaaagagtaccaatagccacaagcgcaagaggcagtcccacagcagtgagagacatgac
aaacactataaatcacttaaaagtgcagacagatacttcagtgatagatccagtcatagg
agagaccatcacgacaggagatatgttgaagaatacagaaatgacttcaatgatacagat
gaccagaaaccttataatagagattatgaaaagagtcactgtcatcattatagcaaatct
catcaaaacagtaaaagtcataaaagaaagcataagaaacatgactccacctacagctcg
catttgaagagccaccgaaggaaaagatccaggagtgtagaggatgatgaggagggtcat
ctggtctgtcaaaatggagacgtactaagagcaagatatgaaattattgccactttaggg
gaaggtgcttttggaaaagtagtggaatgcattgatcatcacatgagggcagtgcatgtc
gccattaaaatagtgaaaaatgttggcagatatcgagaagcagctcgttcagaaattcag
gtattggagcatttaaataccttggatcctagcagcaccttccgttgtgtacagatgttg
gaatggtttgaacatcatggccacatgtgcattgtgtttgagctattgggactcagtact
tatgattttattaaagaaaatagctttttgccttttccgattgaacttattaggaagatg
gcttatcagatttgccaatccataaacttcttgcatcataataagttgactcatacagat
ctgaaacctgaaaatattttatttgtagagtctgattatattgtaaagtacaattcccaa
atgaggcgggatgaacgaacattgaaaaacacagatatcaaagttgtagactttggaagt
gcaacatatgataatgagcatcacagcaccttggtgtctaccagacattacagagcacct
gaagttatattagcccttgggtggtcccagccctgtgatgtttggagtatagggtgcatt
ctgattgagtactaccttggctttacagtctttcaaacacatgatagtaaggaacatctg
gcaatgatgcagagaatactagggcctttaccagtacacatgattaaaaaatcaaggaag
cgctatttccataaaaacgaattggactgggatgaacatagtcatgctgcgcgctacgta
aggaaacggtgcaaaccactgaaggaattcatgcactgtcatgacaaagaccatgagaat
ctttttgaccttcttcgtaagatgttggaatatgatccagtcaagagaattactctagat
gaggcattggagcatcctttctttgatcctttaaaagagagagaacttagttaa

DBGET integrated database retrieval system