KEGG   Anolis carolinensis (green anole): 100566699Help
Entry
100566699         CDS       T01608                                 

Gene name
mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04114  Oocyte meiosis
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04350  TGF-beta signaling pathway
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04540  Gap junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
acs04933  AGE-RAGE signaling pathway in diabetic complications
acs05132  Salmonella infection
Module
acs_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100566699 (mapk3)
   04012 ErbB signaling pathway
    100566699 (mapk3)
   04350 TGF-beta signaling pathway
    100566699 (mapk3)
   04370 VEGF signaling pathway
    100566699 (mapk3)
   04371 Apelin signaling pathway
    100566699 (mapk3)
   04068 FoxO signaling pathway
    100566699 (mapk3)
   04150 mTOR signaling pathway
    100566699 (mapk3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100566699 (mapk3)
  Cell growth and death
   04114 Oocyte meiosis
    100566699 (mapk3)
   04210 Apoptosis
    100566699 (mapk3)
   04218 Cellular senescence
    100566699 (mapk3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100566699 (mapk3)
   04520 Adherens junction
    100566699 (mapk3)
   04540 Gap junction
    100566699 (mapk3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100566699 (mapk3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100566699 (mapk3)
   04621 NOD-like receptor signaling pathway
    100566699 (mapk3)
   04625 C-type lectin receptor signaling pathway
    100566699 (mapk3)
  Endocrine system
   04910 Insulin signaling pathway
    100566699 (mapk3)
   04912 GnRH signaling pathway
    100566699 (mapk3)
   04914 Progesterone-mediated oocyte maturation
    100566699 (mapk3)
   04916 Melanogenesis
    100566699 (mapk3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100566699 (mapk3)
   04270 Vascular smooth muscle contraction
    100566699 (mapk3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100566699 (mapk3)
  Infectious diseases
   05132 Salmonella infection
    100566699 (mapk3)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100566699 (mapk3)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100566699 (mapk3)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100566699 (mapk3)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100566699 (mapk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kdo NDUF_B4
Motif
Other DBs
NCBI-GeneID: 100566699
NCBI-ProteinID: XP_016851543
Ensembl: ENSACAG00000015056
UniProt: H9GLX1
Position
Un
AA seq 375 aa AA seqDB search
MSAATAAAPGGAGAVPVPGAPRLGVETVKGQVFDVGPRYTDLQYIGEGAYGMVCSSYDHV
NKIRAAIKKISPFEHQTYCQRTLREIKILLRFKHENVIGINDILRAPTIDQMRDVYIVQD
LMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKIC
DFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRP
IFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKVPWNKLFPKADPKA
LDLLDKMLTFNPNKRITVEESLAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKEKLKEL
IFEETARFQPGYQGP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcgacagcagcagcgcctggtggggcaggagccgtgccggtgcccggggcg
ccgaggctgggcgtggagacggtgaaagggcaggtcttcgacgtgggcccgcgctacacg
gacctgcagtacatcggcgagggcgcctacggaatggtgtgttcttcttatgaccacgtg
aacaagattcgagctgccatcaaaaagatcagtcccttcgagcatcaaacttattgccaa
cgcacactgcgcgaaataaaaatactactccgctttaaacatgagaacgtcatcggcatc
aatgacattctgcgtgcccctactattgatcagatgcgtgatgtatacatagttcaggat
ttaatggagacagatctgtacaagttgctaaagacccagcaactcagcaacgaccacatc
tgttacttcctctaccagattctccgagggctgaaatacattcattctgccaatgtgctg
catcgggatctaaagcccagcaatcttctcatcaataccacatgtgacctgaagatctgt
gattttggcttggcccgaattgctgatccagaccatgaccacacagggttcttgacagaa
tatgttgccacccgctggtaccgagcccctgaaatcatgctcaattccaagggctacacc
aagtccattgatatatggtctgtgggctgcatcctggcagagatgctgtcgaaccgaccc
atctttcctggcaagcactacctggaccagctcaaccatatcctgggtattctaggttcc
ccatctcaggatgacctgaactgcatcatcaatatgaaggctcgcaactatctccagtcg
ctgccccaaaagcccaaggttccgtggaacaaactgtttcctaaggcagatcccaaagct
ctagacctgttggacaaaatgttgacctttaaccccaacaaacgcatcacagtggaggag
tccttggcccatccttacctagagcagtactacgacccctcagatgagcccgttgctgaa
gagccattcacttttgacatggagctggatgaccttcccaaagagaagctgaaagaactg
atatttgaggagacagcacgcttccagcctggctatcaaggtccctga

DBGET integrated database retrieval system