KEGG   Anolis carolinensis (green anole): 100566699Help
Entry
100566699         CDS       T01608                                 

Gene name
mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Autophagy - animal
mTOR signaling pathway
Apoptosis
Cellular senescence
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
TGF-beta signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100566699 (mapk3)
   04012 ErbB signaling pathway
    100566699 (mapk3)
   04350 TGF-beta signaling pathway
    100566699 (mapk3)
   04370 VEGF signaling pathway
    100566699 (mapk3)
   04371 Apelin signaling pathway
    100566699 (mapk3)
   04068 FoxO signaling pathway
    100566699 (mapk3)
   04150 mTOR signaling pathway
    100566699 (mapk3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100566699 (mapk3)
  Cell growth and death
   04114 Oocyte meiosis
    100566699 (mapk3)
   04210 Apoptosis
    100566699 (mapk3)
   04218 Cellular senescence
    100566699 (mapk3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100566699 (mapk3)
   04520 Adherens junction
    100566699 (mapk3)
   04540 Gap junction
    100566699 (mapk3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100566699 (mapk3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100566699 (mapk3)
   04621 NOD-like receptor signaling pathway
    100566699 (mapk3)
  Endocrine system
   04910 Insulin signaling pathway
    100566699 (mapk3)
   04912 GnRH signaling pathway
    100566699 (mapk3)
   04914 Progesterone-mediated oocyte maturation
    100566699 (mapk3)
   04916 Melanogenesis
    100566699 (mapk3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100566699 (mapk3)
   04270 Vascular smooth muscle contraction
    100566699 (mapk3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100566699 (mapk3)
  Infectious diseases
   05132 Salmonella infection
    100566699 (mapk3)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100566699 (mapk3)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100566699 (mapk3)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100566699 (mapk3)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100566699 (mapk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 375 aa AA seqDB search
MSAATAAAPGGAGAVPVPGAPRLGVETVKGQVFDVGPRYTDLQYIGEGAYGMVCSSYDHV
NKIRAAIKKISPFEHQTYCQRTLREIKILLRFKHENVIGINDILRAPTIDQMRDVYIVQD
LMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKIC
DFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRP
IFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKVPWNKLFPKADPKA
LDLLDKMLTFNPNKRITVEESLAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKEKLKEL
IFEETARFQPGYQGP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcgacagcagcagcgcctggtggggcaggagccgtgccggtgcccggggcg
ccgaggctgggcgtggagacggtgaaagggcaggtcttcgacgtgggcccgcgctacacg
gacctgcagtacatcggcgagggcgcctacggaatggtgtgttcttcttatgaccacgtg
aacaagattcgagctgccatcaaaaagatcagtcccttcgagcatcaaacttattgccaa
cgcacactgcgcgaaataaaaatactactccgctttaaacatgagaacgtcatcggcatc
aatgacattctgcgtgcccctactattgatcagatgcgtgatgtatacatagttcaggat
ttaatggagacagatctgtacaagttgctaaagacccagcaactcagcaacgaccacatc
tgttacttcctctaccagattctccgagggctgaaatacattcattctgccaatgtgctg
catcgggatctaaagcccagcaatcttctcatcaataccacatgtgacctgaagatctgt
gattttggcttggcccgaattgctgatccagaccatgaccacacagggttcttgacagaa
tatgttgccacccgctggtaccgagcccctgaaatcatgctcaattccaagggctacacc
aagtccattgatatatggtctgtgggctgcatcctggcagagatgctgtcgaaccgaccc
atctttcctggcaagcactacctggaccagctcaaccatatcctgggtattctaggttcc
ccatctcaggatgacctgaactgcatcatcaatatgaaggctcgcaactatctccagtcg
ctgccccaaaagcccaaggttccgtggaacaaactgtttcctaaggcagatcccaaagct
ctagacctgttggacaaaatgttgacctttaaccccaacaaacgcatcacagtggaggag
tccttggcccatccttacctagagcagtactacgacccctcagatgagcccgttgctgaa
gagccattcacttttgacatggagctggatgaccttcccaaagagaagctgaaagaactg
atatttgaggagacagcacgcttccagcctggctatcaaggtccctga

DBGET integrated database retrieval system