KEGG   Anolis carolinensis (green anole): 100566746Help
Entry
100566746         CDS       T01608                                 

Gene name
ep300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100566746 (ep300)
   04330 Notch signaling pathway
    100566746 (ep300)
   04350 TGF-beta signaling pathway
    100566746 (ep300)
   04630 Jak-STAT signaling pathway
    100566746 (ep300)
   04068 FoxO signaling pathway
    100566746 (ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100566746 (ep300)
  Cellular commiunity
   04520 Adherens junction
    100566746 (ep300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100566746 (ep300)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100566746 (ep300)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100566746 (ep300)
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100566746 (ep300)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100566746 (ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 2478 aa AA seqDB search
MAENVVESGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLPTSLGMAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMATQPQQNNPGMGILNS
MVKSPMAQAALTSSNLGMGASGPNQGPSTQSTAGMMPAVNSPVTQPGMGMNAGINAGMNP
GMLTAGNGQGMMQGQVMNGSIGAGRGRSNMSYPNPGMGNAGNLLAETLQQGSPQMGGQAG
LRGPQPGGVMNKMGMMNNPSPYVPPYSQNTGQPIGASGLGTQMQNKPVLPNSLPQFPMDK
KPVPGSVMPNMAQQQTPPVQQAGMVSTAPQGMGSGAPTADPEKRKLIQQQLVLLLHAHKC
QRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDC
PVCLPLKNAGDKRNQQSLLGGAAVGLVNSGSVGVGQQTTPNLNATNQIDPSSIERAYAAL
GLTYQGNQMQTQTQAQVKNQQQGQSPQGLRPMNPTNANPMGVNGGVGVQAQSLIPDSMLH
SAMNSQNPMMNENANVASLGAMPTATHPSGIGIRKPWHEDITQDLRNHLVHKLVQAIFPT
PDPAALKDRRMANLVSYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQR
QNMIPNPPGMPPAPMNQGPMGQPQPGMTANGPLPDPNMIRANVPNQMSRLQTPPGMNQFG
SMNMQMPSVGPRQTPPLQHPAQLSQTGTMSQMGFSPRMQQQGVGQPSNQSQFLQQNQFPA
LSPGMNPANTPMTQPGSQTPTSQAQMTSSSCPVTSPAVASGSQGSHIHCPPVPQSTLHRN
SPSPVPSRTPTPHHTPPGLIPQQQQQQQQQQQQQPPAPPQATIASAPATVSQAMASGPQP
QTMHPPQRQTPTPPQAQLTPQVQPPVSVTPSAEQQLPQQPLSQQSTTASVPTPTAALQSQ
HPTTPLSQTGANIDGQVSNPPSASSADVNAQQAAPEQQQQQQQQQPLPEIKMEVKMEEEE
SEQTDLQMEEKPEVKVESMVEECKPEATEQEEKKPEVKQEVKEEEERPSTPGTQSSPASG
QSKRKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGY
CCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPKYGLLADRYHFCEKCFNEIQGES
VALGDDPSQPQTTINKDQFSKRKNDTLDPEQFVECIECGRKMHQICVLHNEIIWPTGFVC
DGCLKKTGRTRRENKFCARRLPTTRLGTFLENRVNEFLRRQNHPESGEVIVRVVHTSEKT
VEVKPGMKARFVDSGEMAEQFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPQPNQRR
VYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHP
PDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNV
LEESIKELEQEEEERKREENTSNESTDVSKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPG
MPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPQANSLPPIIEPDPLIPCDLMDGRDAFLT
LARDKHLEFSSLRRAMWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLC
ITCYNTKNHEHKMEKLGLGIDDESNNQQTATTQSPGDSRRLSIQRCIQSLVHACQCRNAN
CSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQESKCPVPFCLNIKHK
LRQQQLQHRLQQAQMLRRRMASMQRTGIVGQPQGLPSPTPATPTTPTGQQPPTPQTPQPQ
PPPQPASQPQPQPQPPNNMSPFNISRIQPPGTVSQGKAGDQVTPPTTPQTAQPPIQGPPA
AAVEIAMQIQRVADHQRQMAHVPLFQRPIQHPNQMAQMNPIQPMSVTPPQMARGPGGHID
QGMGPTGIQQQPAWAQGGLPQPQQLQQGMQRQSMMSMAQPGQPINMSPQPGMGQVPGAAQ
SKASPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGNQNPQG
MPGQPGMPQGQPGLQQQQAMPGQQGVHPNPAMQNMNPMQAGIQRPSMPQQSPPQQPPPQQ
AMGGMNPQAQPMNMQFRDLLMRRHQMMEQQRQQQQQQQGAGPGLGPGMANHNQFQQPQGV
GYPQQQQQRMQHHMQQLQQGNMGQMSQLPQAMSAETGSSLQQAFQQRLLQQQMGSPAQPN
PMSPQQHMLPNQAQSPHIQGQQIPSSLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPS
PHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQSAMLSQLANNPGMAGLHGASATELGLS
SDNSDLNSNLSQSTLDIH
NT seq 7437 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagtcgggcccgccttcagccaagaggcctaaactatcttca
ccggctctctctgtctctgcaagcgatggcacagattttggatccctctttgatttggaa
catgatttaccagatgaactgatcagctccacagaactgggacttaccaatggcggtgac
attaaccagcttccaactagccttggtatggcacaagatgctgcttctaaacacaaacag
ctgtctgaactactccgagctggtagctcaccaaatcttaatatgggagttggtggtcca
ggccagggcatggccacccaacctcaacaaaacaatcctggaatgggaattttaaacagt
atggtcaaaagccctatggcacaggctgcattaacgtcttcaaacttgggaatgggtgca
agtggaccaaatcaaggtccatcaactcaatccactgcaggaatgatgccagcagtaaac
agtccagtaactcagcctggaatgggaatgaatgcaggaataaatgctggcatgaatcct
ggtatgttgactgcaggaaatggacaaggaatgatgcagggacaagttatgaatggttca
attggagctggaagaggacggtccaacatgtcgtatccaaacccaggaatgggtaatgct
ggtaacttgttggctgagacactgcagcaaggttctccacaaatgggaggacaggcaggc
ttgcggggacctcagcctggtggagtaatgaacaagatgggaatgatgaacaaccccagt
ccttatgtcccaccatacagccagaacactggacaaccaattggagccagtgggcttggc
actcagatgcagaataagccggtattacctaacagcttgcctcagttcccaatggacaag
aagccagtgcctggttcagtaatgcctaacatggctcaacagcagactcctccagttcag
caggctggaatggtgtcaactgccccacagggtatgggatcaggggcacctacagcagac
ccagaaaaacggaagcttattcagcagcaacttgttctcctcttgcatgctcacaaatgt
cagcgacgggaacaagcaaatggtgaggttcgacagtgtaacctccctcattgtcgaacc
atgaagaatgtccttaaccacatgacacattgccaggctggaaaatcctgccaagtggct
cattgtgcatcttcacgacaaatcatatcacactggaaaaattgtacacggcatgattgt
ccggtgtgtctcccactcaagaatgctggagacaaaagaaatcaacaatcattattaggt
ggtgctgcagtgggacttgtcaattctgggtctgtaggagttggacaacaaacgacaccc
aacttaaatgctactaaccagattgatcccagctctattgaaagggcttatgccgctctt
ggactgacgtatcaagggaaccagatgcaaacccagactcaagctcaagtgaagaaccaa
caacagggacagtcaccacaaggtcttcgccccatgaatcccacgaatgctaatcctatg
ggagtgaatggaggtgttggagttcaagcccaaagtctgatacctgattcaatgttgcat
tcagctatgaattctcaaaaccctatgatgaacgaaaatgctaatgttgccagtctaggg
gctatgccaactgcaactcatccatctggcattgggattcgaaaaccatggcatgaagat
attactcaggacctccgaaatcaccttgttcataaactagtacaagccatatttccaacg
cccgatcctgcagcactaaaagataggcgcatggcaaatcttgtctcttatgctcggaaa
gtagaaggagacatgtatgaatcagcaaatagtagggcagagtactaccacttattagca
gagaagatttataaaatccagaaggaactggaggaaaagaggagaacaagactgcagagg
cagaacatgatcccaaatcccccaggcatgccaccagctcctatgaatcaagggcctatg
gggcagccgcagcctggaatgacagcaaatggtcctcttcctgacccaaatatgatccgt
gccaatgtgccaaaccagatgagtcgcttgcagacaccaccaggaatgaatcagtttggc
tcaatgaacatgcagatgccatcggttggaccccggcaaactcctccccttcagcatcct
gcacagctaagccagacagggaccatgagccagatgggattttccccacgtatgcaacag
caaggggttggacagccttctaatcaaagtcagtttctgcagcagaaccagtttcctgca
ttgtcaccaggaatgaatccagcaaacacgcctatgactcaacctggcagtcagactcct
acttctcaagcacaaatgaccagctcttcctgtcctgtgacttctcctgctgtggcttca
ggttcccaagggagccatattcattgcccccctgttccacagtctactttgcatagaaac
tctccttctccagttccaagtcgtactcctacacctcaccatacgcccccaggtctgata
ccccaacagcagcagcagcaacagcagcagcagcagcagcagccaccagcaccaccacaa
gcgacaattgcttctgctcctgccacagtgtctcaagcaatggcatctggaccgcagcct
caaactatgcatcccccccagagacaaactccaacgcctccccaggctcagttgactcca
caagtgcagcctccagtctctgtgaccccttcagcagagcagcagctgccacagcagcct
ctttcacagcagagcaccactgcatctgtacccaccccaacagcagcactgcagtctcag
catcctacaacacctctttcacagacaggtgcaaatattgatgggcaagtatcaaaccca
ccatctgccagcagtgcagatgtcaacgctcaacaggctgctcctgagcagcagcagcag
caacaacaacagcaacctctgcctgaaatcaaaatggaagttaaaatggaagaggaagag
tcagaacagacagatttgcaaatggaagaaaaaccagaggttaaagtagaatccatggta
gaagaatgtaaacctgaagcaacagagcaagaagagaagaaaccagaagtgaagcaagag
gtgaaggaggaagaggaaagaccaagtactccaggtactcagtcttcaccagcgtcagga
cagtcaaagagaaaaattttcaagccagaagagttgaggcaggcacttatgccaactttg
gaggcactttaccgtcaggaccctgagtcccttcctttcaggcagcctgtggatccccag
ctactaggaattccggattattttgatatagtgaagaaccccatggatctttctaccatc
aagaggaagcttgacacaggacagtatcaggagccctggcaatacgttgatgacatttgg
cttatgttcaataatgcctggctttacaaccgcaaaacatctagagtgtataagtattgt
tccaagttggcagaggtgtttgagcaggaaattgatccagttatgcagagccttggatat
tgctgtggacgaaagttggagttttcaccacagacattatgttgctatggaaaacagtta
tgcacaatcccaagggatgctacatattacagttaccaaaacagttcacccaaatatggc
cttcttgccgacaggtatcatttctgtgagaagtgcttcaacgaaatccaaggggagagc
gttgctttgggggatgacccatcacaaccacaaacaacaataaataaagatcaattttca
aaaagaaaaaatgacacactggatcctgaacaatttgttgaatgtatagagtgtggaaga
aaaatgcatcagatttgtgtgcttcacaatgagattatctggccaactggctttgtttgt
gatggttgcttaaagaaaactggacgaacccgaagagaaaataaattctgtgctagacgg
ttgccaactacaagacttggtacattcttggagaacagagttaatgagttcctgagaaga
caaaatcatcctgagtcaggcgaagtcatagttagggtggttcatacttcagaaaaaact
gtagaagttaagccaggaatgaaagcaaggtttgtagatagtggagagatggcagaacag
ttcccttatcgaacaaaagccctctttgcttttgaggagattgatggtgtagatttgtgc
ttttttggaatgcacgttcaggaatatgggtcagactgccctcagcccaaccagagacga
gtatacatatcataccttgacagtgttcatttcttccgccctaaatgcttgaggactgct
gtatatcatgaaatactaataggatacctagaatatgtcaagaagttgggatatacaact
ggacatatctgggcctgcccacctagtgaaggagatgattacattttccattgtcatcca
cctgaccaaaagatacccaaaccgaaacgactgcaggaatggtacaaaaagatgttggat
aaatctgtgtcagagcgcatagtccatgattataaggatatttttaagcaggcaacagaa
gaccgtctaacaagtgcaaaagagctgccttactttgagggagatttttggccaaatgtt
ctagaagaaagcattaaggagctagaacaagaggaggaggagcggaagagagaagagaac
actagcaatgagagcactgatgttagcaaaggagatagcaaaaatgccaaaaagaagaat
aacaaaaagactagcaaaaataagagtagcttgagccgtggaaataaaaagaagcctgga
atgcccaatgtctccaatgacctttcccagaaactgtatgccactatggagaagcacaag
gaggtattctttgtgatccgtctcattgctggccctcaagctaattcattgcctcccatt
attgaaccagacccacttattccatgtgacttaatggatgggcgtgatgccttccttacc
cttgctagagataaacaccttgagttttcttcactacgaagggcaatgtggtcaactatg
tgtatgctggtagagctacacacacagagtcaggaccgatttgtttatacctgcaatgag
tgcaagcaccatgtggagacaagatggcattgcacagtctgtgaggattatgacctctgc
atcacctgctataacactaaaaaccatgagcacaagatggagaaactgggtcttggtatt
gatgacgagagcaacaaccaacagacagccaccacgcagagccctggggattcccgccgc
ctgagcatccaacgctgcattcagtctctggtgcatgcctgccagtgtcgcaatgccaac
tgctcactgccgtcctgtcagaagatgaaaagggttgtgcagcacactaaaggctgcaag
cgcaaaaccaacggagggtgcccaatttgcaagcagcttattgccctttgctgctaccat
gctaagcactgccaggagagcaagtgcccagtgcccttctgcctcaacatcaaacacaag
cttcgtcagcaacagcttcagcaccgtttgcagcaagctcagatgctccgcaggaggatg
gcaagcatgcagaggaccggcatagtaggtcagccgcaggggttgccttcaccaacacca
gctacgccaacaactcctacaggacagcagccaccaacccctcagaccccgcagccgcag
cctccaccccagcctgcctcacagccacagccgcagccgcagcctcccaataacatgtct
ccatttaatatttcaagaattcagcctcctggaactgtgtctcaaggcaaggccggtgac
caggtaactcctccgacaactcctcagactgctcagccgcctattcagggccctcctgca
gctgcggtagaaatagccatgcagatacaacgagtagcagatcaccagcggcagatggct
catgttcctctcttccagaggccaattcaacacccaaaccagatggcccaaatgaatccg
atacagcccatgagtgttacaccacctcagatggccaggggtcccggtggccacatagat
caagggatgggaccaacaggaattcagcaacagccagcttgggcccagggagggttgcct
cagcctcagcaactgcagcagggaatgcagagacaatcgatgatgtcaatggcccagcct
gggcagccgatcaatatgtccccacagccaggaatgggtcaagtaccaggtgcagctcag
tcgaaagcaagtcctctgccccaggcagccttacaaaacctgctgcggactctcaggtct
cccagctctcccatgcagcagcagcaggtgcttaacatcctgcattccaaccctcaactc
ttagctgctttcatcaagcagcgggctgccaagtatgctgggaaccagaatccacagggc
atgccagggcaacctggaatgcctcaggggcaaccagggctgcagcagcaacaggctatg
ccagggcagcaaggtgtgcacccaaatccagccatgcaaaacatgaatccaatgcaagca
ggcattcagaggcccagcatgcctcagcagtcaccacctcagcagcctccaccccagcag
gctatgggtggaatgaatcctcaggcacagccaatgaacatgcagttccgggacctctta
atgaggcggcatcaaatgatggagcagcagcgtcagcagcaacaacagcagcaaggcgca
ggccctgggttgggtcccggcatggccaaccataaccagttccaacagccgcagggagtt
ggatacccccaacagcagcagcagcggatgcaacaccacatgcagcagctgcagcaagga
aacatgggacaaatgagccagcttccacaagcaatgagcgcagaaacaggatcgagtctg
cagcaggctttccagcagcgactactccagcagcagatgggatcaccagctcagcccaat
cccatgagtcctcagcagcacatgctcccaaaccaggcccagtccccacacatacaaggc
cagcagatcccatcgtcactcaccaaccaagtgcgttcgccacagcctgtcccctcaccg
cggccccagtcccagcctccccactccagcccttcccctcgaatgcaaccacaaccttct
ccccaccacgtctccccacagaccagctccccacatccaggactggtagctgcccaggct
aaccccatggatcaagggcactttgccagcccggaccagagtgcaatgctttctcagctt
gcaaataatccaggcatggcgggtctccatggtgcaagtgccacagaactgggactcagc
tcagataattcagacttaaactcaaatctttcacagagtacactagacatacactaa

DBGET integrated database retrieval system