KEGG   Anolis carolinensis (green anole): 100566746Help
Entry
100566746         CDS       T01608                                 

Gene name
ep300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100566746 (ep300)
   04330 Notch signaling pathway
    100566746 (ep300)
   04350 TGF-beta signaling pathway
    100566746 (ep300)
   04068 FoxO signaling pathway
    100566746 (ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100566746 (ep300)
  Cellular community - eukaryotes
   04520 Adherens junction
    100566746 (ep300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100566746 (ep300)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100566746 (ep300)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100566746 (ep300)
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100566746 (ep300)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100566746 (ep300)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100566746 (ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 2468 aa AA seqDB search
MAENVVESGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLPTSLGMAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMATQPQQNNPGMGILNS
MVKSPMAQAALTSSNLGMGASGPNQGPSTQSTAGMMPAVNSPVTQPGMGMNAGINAGMNP
GMLTAGNGQGMMQGQVMNGSIGAGRGRSNMSYPNPGMGNAGNLLAETLQQGSPQMGGQAG
LRGPQPGGVMNKMGMMNNPSPYVPPYSQNTGQPIGASGLGTQMQNKPVLPNSLPQFPMDK
KPVPGSVMPNMAQQQTPPVQQAGMVSTAPQGMGSGAPTADPEKRKLIQQQLVLLLHAHKC
QRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDC
PVCLPLKNAGDKRNQQSLLGGAAVGLVNSGSVGVGQQTTPNLNATNQIDPSSIERAYAAL
GLTYQGNQMQTQTQAQVKNQQQGQSPQGLRPMNPTNANPMGVNGGVGVQAQSLIPDSMLH
SAMNSQNPMMNENANVASLGAMPTATHPSGIGIRKPWHEDITQDLRNHLVHKLVQAIFPT
PDPAALKDRRMANLVSYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQR
QNMIPNPPGMPPAPMNQGPMGQPQPGMTANGPLPDPNMIRANVPNQMSRLQTPPGMNQFG
SMNMQMPSVGPRQTPPLQHPAQLSQTGTMSQMGFSPRMQQQGVGQPSNQSQFLQQNQFPA
LSPGMNPANTPMTQPGSQTPTSQAQMTSSSCPVTSPAVASGSQGSHIHCPPVPQSTLHRN
SPSPVPSRTPTPHHTPPGLIPQQQQQQQQQQQQQPPAPPQATIASAPATVSQAMASGPQP
QTMHPPQRQTPTPPQAQLTPQVQPPVSVTPSAEQQLPQQPLSQQSTTASVPTPTAALQSQ
HPTTPLSQTGANIDGQVSNPPSASSADVNAQQAAPEQQQQQQQQQPLPEIKMEVKMEEEE
SEQTDLQMEEKPEVKVESMVEECKPEATEQEEKKPEVKQEVKEEEERPSTPGTQSSPASG
QSKRKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGY
CCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVALGDDPSQP
QTTINKDQFSKRKNDTLDPEQFVECIECGRKMHQICVLHNEIIWPTGFVCDGCLKKTGRT
RRENKFCARRLPTTRLGTFLENRVNEFLRRQNHPESGEVIVRVVHTSEKTVEVKPGMKAR
FVDSGEMAEQFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPQPNQRRVYISYLDSVH
FFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKR
LQEWYKKMLDKSVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQ
EEEERKREENTSNESTDVSKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQ
KLYATMEKHKEVFFVIRLIAGPQANSLPPIIEPDPLIPCDLMDGRDAFLTLARDKHLEFS
SLRRAMWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHE
HKMEKLGLGIDDESNNQQTATTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMK
RVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQESKCPVPFCLNIKHKLRQQQLQHRL
QQAQMLRRRMASMQRTGIVGQPQGLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPASQPQ
PQPQPPNNMSPFNISRIQPPGTVSQGKAGDQVTPPTTPQTAQPPIQGPPAAAVEIAMQIQ
RVADHQRQMAHVPLFQRPIQHPNQMAQMNPIQPMSVTPPQMARGPGGHIDQGMGPTGIQQ
QPAWAQGGLPQPQQLQQGMQRQSMMSMAQPGQPINMSPQPGMGQVPGAAQSKASPLPQAA
LQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGNQNPQGMPGQPGMPQG
QPGLQQQQAMPGQQGVHPNPAMQNMNPMQAGIQRPSMPQQSPPQQPPPQQAMGGMNPQAQ
PMNMQFRDLLMRRHQMMEQQRQQQQQQQGAGPGLGPGMANHNQFQQPQGVGYPQQQQQRM
QHHMQQLQQGNMGQMSQLPQAMSAETGSSLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLP
NQAQSPHIQGQQIPSSLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSS
PHPGLVAAQANPMDQGHFASPDQSAMLSQLANNPGMAGLHGASATELGLSSDNSDLNSNL
SQSTLDIH
NT seq 7407 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagtcgggcccgccttcagccaagaggcctaaactatcttca
ccggctctctctgtctctgcaagcgatggcacagattttggatccctctttgatttggaa
catgatttaccagatgaactgatcagctccacagaactgggacttaccaatggcggtgac
attaaccagcttccaactagccttggtatggcacaagatgctgcttctaaacacaaacag
ctgtctgaactactccgagctggtagctcaccaaatcttaatatgggagttggtggtcca
ggccagggcatggccacccaacctcaacaaaacaatcctggaatgggaattttaaacagt
atggtcaaaagccctatggcacaggctgcattaacgtcttcaaacttgggaatgggtgca
agtggaccaaatcaaggtccatcaactcaatccactgcaggaatgatgccagcagtaaac
agtccagtaactcagcctggaatgggaatgaatgcaggaataaatgctggcatgaatcct
ggtatgttgactgcaggaaatggacaaggaatgatgcagggacaagttatgaatggttca
attggagctggaagaggacggtccaacatgtcgtatccaaacccaggaatgggtaatgct
ggtaacttgttggctgagacactgcagcaaggttctccacaaatgggaggacaggcaggc
ttgcggggacctcagcctggtggagtaatgaacaagatgggaatgatgaacaaccccagt
ccttatgtcccaccatacagccagaacactggacaaccaattggagccagtgggcttggc
actcagatgcagaataagccggtattacctaacagcttgcctcagttcccaatggacaag
aagccagtgcctggttcagtaatgcctaacatggctcaacagcagactcctccagttcag
caggctggaatggtgtcaactgccccacagggtatgggatcaggggcacctacagcagac
ccagaaaaacggaagcttattcagcagcaacttgttctcctcttgcatgctcacaaatgt
cagcgacgggaacaagcaaatggtgaggttcgacagtgtaacctccctcattgtcgaacc
atgaagaatgtccttaaccacatgacacattgccaggctggaaaatcctgccaagtggct
cattgtgcatcttcacgacaaatcatatcacactggaaaaattgtacacggcatgattgt
ccggtgtgtctcccactcaagaatgctggagacaaaagaaatcaacaatcattattaggt
ggtgctgcagtgggacttgtcaattctgggtctgtaggagttggacaacaaacgacaccc
aacttaaatgctactaaccagattgatcccagctctattgaaagggcttatgccgctctt
ggactgacgtatcaagggaaccagatgcaaacccagactcaagctcaagtgaagaaccaa
caacagggacagtcaccacaaggtcttcgccccatgaatcccacgaatgctaatcctatg
ggagtgaatggaggtgttggagttcaagcccaaagtctgatacctgattcaatgttgcat
tcagctatgaattctcaaaaccctatgatgaacgaaaatgctaatgttgccagtctaggg
gctatgccaactgcaactcatccatctggcattgggattcgaaaaccatggcatgaagat
attactcaggacctccgaaatcaccttgttcataaactagtacaagccatatttccaacg
cccgatcctgcagcactaaaagataggcgcatggcaaatcttgtctcttatgctcggaaa
gtagaaggagacatgtatgaatcagcaaatagtagggcagagtactaccacttattagca
gagaagatttataaaatccagaaggaactggaggaaaagaggagaacaagactgcagagg
cagaacatgatcccaaatcccccaggcatgccaccagctcctatgaatcaagggcctatg
gggcagccgcagcctggaatgacagcaaatggtcctcttcctgacccaaatatgatccgt
gccaatgtgccaaaccagatgagtcgcttgcagacaccaccaggaatgaatcagtttggc
tcaatgaacatgcagatgccatcggttggaccccggcaaactcctccccttcagcatcct
gcacagctaagccagacagggaccatgagccagatgggattttccccacgtatgcaacag
caaggggttggacagccttctaatcaaagtcagtttctgcagcagaaccagtttcctgca
ttgtcaccaggaatgaatccagcaaacacgcctatgactcaacctggcagtcagactcct
acttctcaagcacaaatgaccagctcttcctgtcctgtgacttctcctgctgtggcttca
ggttcccaagggagccatattcattgcccccctgttccacagtctactttgcatagaaac
tctccttctccagttccaagtcgtactcctacacctcaccatacgcccccaggtctgata
ccccaacagcagcagcagcaacagcagcagcagcagcagcagccaccagcaccaccacaa
gcgacaattgcttctgctcctgccacagtgtctcaagcaatggcatctggaccgcagcct
caaactatgcatcccccccagagacaaactccaacgcctccccaggctcagttgactcca
caagtgcagcctccagtctctgtgaccccttcagcagagcagcagctgccacagcagcct
ctttcacagcagagcaccactgcatctgtacccaccccaacagcagcactgcagtctcag
catcctacaacacctctttcacagacaggtgcaaatattgatgggcaagtatcaaaccca
ccatctgccagcagtgcagatgtcaacgctcaacaggctgctcctgagcagcagcagcag
caacaacaacagcaacctctgcctgaaatcaaaatggaagttaaaatggaagaggaagag
tcagaacagacagatttgcaaatggaagaaaaaccagaggttaaagtagaatccatggta
gaagaatgtaaacctgaagcaacagagcaagaagagaagaaaccagaagtgaagcaagag
gtgaaggaggaagaggaaagaccaagtactccaggtactcagtcttcaccagcgtcagga
cagtcaaagagaaaaattttcaagccagaagagttgaggcaggcacttatgccaactttg
gaggcactttaccgtcaggaccctgagtcccttcctttcaggcagcctgtggatccccag
ctactaggaattccggattattttgatatagtgaagaaccccatggatctttctaccatc
aagaggaagcttgacacaggacagtatcaggagccctggcaatacgttgatgacatttgg
cttatgttcaataatgcctggctttacaaccgcaaaacatctagagtgtataagtattgt
tccaagttggcagaggtgtttgagcaggaaattgatccagttatgcagagccttggatat
tgctgtggacgaaagttggagttttcaccacagacattatgttgctatggaaaacagtta
tgcacaatcccaagggatgctacatattacagttaccaaaacaggtatcatttctgtgag
aagtgcttcaacgaaatccaaggggagagcgttgctttgggggatgacccatcacaacca
caaacaacaataaataaagatcaattttcaaaaagaaaaaatgacacactggatcctgaa
caatttgttgaatgtatagagtgtggaagaaaaatgcatcagatttgtgtgcttcacaat
gagattatctggccaactggctttgtttgtgatggttgcttaaagaaaactggacgaacc
cgaagagaaaataaattctgtgctagacggttgccaactacaagacttggtacattcttg
gagaacagagttaatgagttcctgagaagacaaaatcatcctgagtcaggcgaagtcata
gttagggtggttcatacttcagaaaaaactgtagaagttaagccaggaatgaaagcaagg
tttgtagatagtggagagatggcagaacagttcccttatcgaacaaaagccctctttgct
tttgaggagattgatggtgtagatttgtgcttttttggaatgcacgttcaggaatatggg
tcagactgccctcagcccaaccagagacgagtatacatatcataccttgacagtgttcat
ttcttccgccctaaatgcttgaggactgctgtatatcatgaaatactaataggataccta
gaatatgtcaagaagttgggatatacaactggacatatctgggcctgcccacctagtgaa
ggagatgattacattttccattgtcatccacctgaccaaaagatacccaaaccgaaacga
ctgcaggaatggtacaaaaagatgttggataaatctgtgtcagagcgcatagtccatgat
tataaggatatttttaagcaggcaacagaagaccgtctaacaagtgcaaaagagctgcct
tactttgagggagatttttggccaaatgttctagaagaaagcattaaggagctagaacaa
gaggaggaggagcggaagagagaagagaacactagcaatgagagcactgatgttagcaaa
ggagatagcaaaaatgccaaaaagaagaataacaaaaagactagcaaaaataagagtagc
ttgagccgtggaaataaaaagaagcctggaatgcccaatgtctccaatgacctttcccag
aaactgtatgccactatggagaagcacaaggaggtattctttgtgatccgtctcattgct
ggccctcaagctaattcattgcctcccattattgaaccagacccacttattccatgtgac
ttaatggatgggcgtgatgccttccttacccttgctagagataaacaccttgagttttct
tcactacgaagggcaatgtggtcaactatgtgtatgctggtagagctacacacacagagt
caggaccgatttgtttatacctgcaatgagtgcaagcaccatgtggagacaagatggcat
tgcacagtctgtgaggattatgacctctgcatcacctgctataacactaaaaaccatgag
cacaagatggagaaactgggtcttggtattgatgacgagagcaacaaccaacagacagcc
accacgcagagccctggggattcccgccgcctgagcatccaacgctgcattcagtctctg
gtgcatgcctgccagtgtcgcaatgccaactgctcactgccgtcctgtcagaagatgaaa
agggttgtgcagcacactaaaggctgcaagcgcaaaaccaacggagggtgcccaatttgc
aagcagcttattgccctttgctgctaccatgctaagcactgccaggagagcaagtgccca
gtgcccttctgcctcaacatcaaacacaagcttcgtcagcaacagcttcagcaccgtttg
cagcaagctcagatgctccgcaggaggatggcaagcatgcagaggaccggcatagtaggt
cagccgcaggggttgccttcaccaacaccagctacgccaacaactcctacaggacagcag
ccaccaacccctcagaccccgcagccgcagcctccaccccagcctgcctcacagccacag
ccgcagccgcagcctcccaataacatgtctccatttaatatttcaagaattcagcctcct
ggaactgtgtctcaaggcaaggccggtgaccaggtaactcctccgacaactcctcagact
gctcagccgcctattcagggccctcctgcagctgcggtagaaatagccatgcagatacaa
cgagtagcagatcaccagcggcagatggctcatgttcctctcttccagaggccaattcaa
cacccaaaccagatggcccaaatgaatccgatacagcccatgagtgttacaccacctcag
atggccaggggtcccggtggccacatagatcaagggatgggaccaacaggaattcagcaa
cagccagcttgggcccagggagggttgcctcagcctcagcaactgcagcagggaatgcag
agacaatcgatgatgtcaatggcccagcctgggcagccgatcaatatgtccccacagcca
ggaatgggtcaagtaccaggtgcagctcagtcgaaagcaagtcctctgccccaggcagcc
ttacaaaacctgctgcggactctcaggtctcccagctctcccatgcagcagcagcaggtg
cttaacatcctgcattccaaccctcaactcttagctgctttcatcaagcagcgggctgcc
aagtatgctgggaaccagaatccacagggcatgccagggcaacctggaatgcctcagggg
caaccagggctgcagcagcaacaggctatgccagggcagcaaggtgtgcacccaaatcca
gccatgcaaaacatgaatccaatgcaagcaggcattcagaggcccagcatgcctcagcag
tcaccacctcagcagcctccaccccagcaggctatgggtggaatgaatcctcaggcacag
ccaatgaacatgcagttccgggacctcttaatgaggcggcatcaaatgatggagcagcag
cgtcagcagcaacaacagcagcaaggcgcaggccctgggttgggtcccggcatggccaac
cataaccagttccaacagccgcagggagttggatacccccaacagcagcagcagcggatg
caacaccacatgcagcagctgcagcaaggaaacatgggacaaatgagccagcttccacaa
gcaatgagcgcagaaacaggatcgagtctgcagcaggctttccagcagcgactactccag
cagcagatgggatcaccagctcagcccaatcccatgagtcctcagcagcacatgctccca
aaccaggcccagtccccacacatacaaggccagcagatcccatcgtcactcaccaaccaa
gtgcgttcgccacagcctgtcccctcaccgcggccccagtcccagcctccccactccagc
ccttcccctcgaatgcaaccacaaccttctccccaccacgtctccccacagaccagctcc
ccacatccaggactggtagctgcccaggctaaccccatggatcaagggcactttgccagc
ccggaccagagtgcaatgctttctcagcttgcaaataatccaggcatggcgggtctccat
ggtgcaagtgccacagaactgggactcagctcagataattcagacttaaactcaaatctt
tcacagagtacactagacatacactaa

DBGET integrated database retrieval system