KEGG   Anolis carolinensis (green anole): 100566746Help
Entry
100566746         CDS       T01608                                 

Gene name
ep300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:acs04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:acs04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:acs04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:acs04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:acs04110]
Cellular Processes; Cell communication; Adherens junction [PATH:acs04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:acs04916]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:acs05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 2463 aa AA seqDB search
MAENVVESGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLPTSLGMAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMATQPQQNNPGMGILNS
MVKSPMAQAALTSSNLGMGASGPNQGPSTQSTAGMMPAVNSPVTQPGMGMNAGINAGMNP
GMLTAGNGQGMMQGQVMNGSIGAGRGRSNMSYPNPGMGNAGNLLAETLQQGSPQMGGQAG
LRGPQPGGMGMMNNPSPYVPPYSQNTGQPIGASGLGTQMQNKPVLPNSLPQFPMDKKPVP
GSVMPNMAQQQTPPVQQAGMVSTAPQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQRRE
QANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCL
PLKNAGDKRNQQSLLGGAAVGLVNSGSVGVGQQTTPNLNATNQIDPSSIERAYAALGLTY
QGNQMQTQTQAQVKNQQQGQSPQGLRPMNPTNANPMGVNGGVGVQAQSLIPDSMLHSAMN
SQNPMMNENANVASLGAMPTATHPSGIGIRKPWHEDITQDLRNHLVHKLVQAIFPTPDPA
ALKDRRMANLVSYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQRQNMI
PNPPGMPPAPMNQGPMGQPQPGMTANGPLPDPNMIRANVPNQMSRLQTPPGMNQFGSMNM
QMPSVGPRQTPPLQHPAQLSQTGTMSQMGFSPRMQQQGVGQPSNQSQFLQQNQFPALSPG
MNPANTPMTQPGSQTPTSQAQMTSSSCPVTSPAVASGSQGSHIHCPPVPQSTLHRNSPSP
VPSRTPTPHHTPPGLIPQQQQQQQQQQQQQPPAPPQATIASAPATVSQAMASGPQPQTMH
PPQRQTPTPPQAQLTPQVQPPVSVTPSAEQQLPQQPLSQQSTTASVPTPTAALQSQHPTT
PLSQTGANIDGQVSNPPSASSADVNAQQAAPEQQQQQQQQQPLPEIKMEVKMEEEESEQT
DLQMEEKPEVIESMVEECKPEATEQEEKKPEVKQEVKEEEERPSTPGTQSSPASGQSKRK
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLD
TGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRK
LEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVALGDDPSQPQTTIN
KDQFSKRKNDTLDPEQFVECIECGRKMHQICVLHNEIIWPTGFVCDGCLKKTGRTRRENK
FCARRLPTTRLGTFLENRVNEFLRRQNHPESGEVIVRVVHTSEKTVEVKPGMKARFVDSG
EMAEQFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPK
CLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWY
KKMLDKSVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEER
KREENTSNESTDVSKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYAT
MEKHKEVFFVIRLIAGPQANSLPPIIEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRA
MWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHEHKMEK
LGLGIDDESNNQQTATTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQH
TKGCKRKTNGGCPICKQLIALCCYHAKHCQESKCPVPFCLNIKHKLRQQQLQHRLQQAQM
LRRRMASMQRTGIVGQPQGLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPASQPQPQPQP
PNNMSPFNISRIQPPGTVSQGKAGDQVTPPTTPQTAQPPIQGPPAAAVEIAMQIQRVADH
QRQMAHVPLFQRPIQHPNQMAQMNPIQPMSVTPPQMARGPGGHIDQGMGPTGIQQQPAWA
QGGLPQPQQLQQGMQRQSMMSMAQPGQPINMSPQPGMGQVPGAAQSKASPLPQAALQNLL
RTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGNQNPQGMPGQPGMPQGQPGLQ
QQQAMPGQQGVHPNPAMQNMNPMQAGIQRPSMPQQSPPQQPPPQQAMGGMNPQAQPMNMQ
FRDLLMRRHQMMEQQRQQQQQQQGAGPGLGPGMANHNQFQQPQGVGYPQQQQQRMQHHMQ
QLQQGNMGQMSQLPQAMSAETGSSLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQS
PHIQGQQIPSSLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGL
VAAQANPMDQGHFASPDQSAMLSQLANNPGMAGLHGASATELGLSSDNSDLNSNLSQSTL
DIH
NT seq 7392 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagtcgggcccgccttcagccaagaggcctaaactatcttca
ccggctctctctgtctctgcaagcgatggcacagattttggatccctctttgatttggaa
catgatttaccagatgaactgatcagctccacagaactgggacttaccaatggcggtgac
attaaccagcttccaactagccttggtatggcacaagatgctgcttctaaacacaaacag
ctgtctgaactactccgagctggtagctcaccaaatcttaatatgggagttggtggtcca
ggccagggcatggccacccaacctcaacaaaacaatcctggaatgggaattttaaacagt
atggtcaaaagccctatggcacaggctgcattaacgtcttcaaacttgggaatgggtgca
agtggaccaaatcaaggtccatcaactcaatccactgcaggaatgatgccagcagtaaac
agtccagtaactcagcctggaatgggaatgaatgcaggaataaatgctggcatgaatcct
ggtatgttgactgcaggaaatggacaaggaatgatgcagggacaagttatgaatggttca
attggagctggaagaggacggtccaacatgtcgtatccaaacccaggaatgggtaatgct
ggtaacttgttggctgagacactgcagcaaggttctccacaaatgggaggacaggcaggc
ttgcggggacctcagcctggtggaatgggaatgatgaacaaccccagtccttatgtccca
ccatacagccagaacactggacaaccaattggagccagtgggcttggcactcagatgcag
aataagccggtattacctaacagcttgcctcagttcccaatggacaagaagccagtgcct
ggttcagtaatgcctaacatggctcaacagcagactcctccagttcagcaggctggaatg
gtgtcaactgccccacagggtatgggatcaggggcacctacagcagacccagaaaaacgg
aagcttattcagcagcaacttgttctcctcttgcatgctcacaaatgtcagcgacgggaa
caagcaaatggtgaggttcgacagtgtaacctccctcattgtcgaaccatgaagaatgtc
cttaaccacatgacacattgccaggctggaaaatcctgccaagtggctcattgtgcatct
tcacgacaaatcatatcacactggaaaaattgtacacggcatgattgtccggtgtgtctc
ccactcaagaatgctggagacaaaagaaatcaacaatcattattaggtggtgctgcagtg
ggacttgtcaattctgggtctgtaggagttggacaacaaacgacacccaacttaaatgct
actaaccagattgatcccagctctattgaaagggcttatgccgctcttggactgacgtat
caagggaaccagatgcaaacccagactcaagctcaagtgaagaaccaacaacagggacag
tcaccacaaggtcttcgccccatgaatcccacgaatgctaatcctatgggagtgaatgga
ggtgttggagttcaagcccaaagtctgatacctgattcaatgttgcattcagctatgaat
tctcaaaaccctatgatgaacgaaaatgctaatgttgccagtctaggggctatgccaact
gcaactcatccatctggcattgggattcgaaaaccatggcatgaagatattactcaggac
ctccgaaatcaccttgttcataaactagtacaagccatatttccaacgcccgatcctgca
gcactaaaagataggcgcatggcaaatcttgtctcttatgctcggaaagtagaaggagac
atgtatgaatcagcaaatagtagggcagagtactaccacttattagcagagaagatttat
aaaatccagaaggaactggaggaaaagaggagaacaagactgcagaggcagaacatgatc
ccaaatcccccaggcatgccaccagctcctatgaatcaagggcctatggggcagccgcag
cctggaatgacagcaaatggtcctcttcctgacccaaatatgatccgtgccaatgtgcca
aaccagatgagtcgcttgcagacaccaccaggaatgaatcagtttggctcaatgaacatg
cagatgccatcggttggaccccggcaaactcctccccttcagcatcctgcacagctaagc
cagacagggaccatgagccagatgggattttccccacgtatgcaacagcaaggggttgga
cagccttctaatcaaagtcagtttctgcagcagaaccagtttcctgcattgtcaccagga
atgaatccagcaaacacgcctatgactcaacctggcagtcagactcctacttctcaagca
caaatgaccagctcttcctgtcctgtgacttctcctgctgtggcttcaggttcccaaggg
agccatattcattgcccccctgttccacagtctactttgcatagaaactctccttctcca
gttccaagtcgtactcctacacctcaccatacgcccccaggtctgataccccaacagcag
cagcagcaacagcagcagcagcagcagcagccaccagcaccaccacaagcgacaattgct
tctgctcctgccacagtgtctcaagcaatggcatctggaccgcagcctcaaactatgcat
cccccccagagacaaactccaacgcctccccaggctcagttgactccacaagtgcagcct
ccagtctctgtgaccccttcagcagagcagcagctgccacagcagcctctttcacagcag
agcaccactgcatctgtacccaccccaacagcagcactgcagtctcagcatcctacaaca
cctctttcacagacaggtgcaaatattgatgggcaagtatcaaacccaccatctgccagc
agtgcagatgtcaacgctcaacaggctgctcctgagcagcagcagcagcaacaacaacag
caacctctgcctgaaatcaaaatggaagttaaaatggaagaggaagagtcagaacagaca
gatttgcaaatggaagaaaaaccagaggtgatagaatccatggtagaagaatgtaaacct
gaagcaacagagcaagaagagaagaaaccagaagtgaagcaagaggtgaaggaggaagag
gaaagaccaagtactccaggtactcagtcttcaccagcgtcaggacagtcaaagagaaaa
attttcaagccagaagagttgaggcaggcacttatgccaactttggaggcactttaccgt
caggaccctgagtcccttcctttcaggcagcctgtggatccccagctactaggaattccg
gattattttgatatagtgaagaaccccatggatctttctaccatcaagaggaagcttgac
acaggacagtatcaggagccctggcaatacgttgatgacatttggcttatgttcaataat
gcctggctttacaaccgcaaaacatctagagtgtataagtattgttccaagttggcagag
gtgtttgagcaggaaattgatccagttatgcagagccttggatattgctgtggacgaaag
ttggagttttcaccacagacattatgttgctatggaaaacagttatgcacaatcccaagg
gatgctacatattacagttaccaaaacaggtatcatttctgtgagaagtgcttcaacgaa
atccaaggggagagcgttgctttgggggatgacccatcacaaccacaaacaacaataaat
aaagatcaattttcaaaaagaaaaaatgacacactggatcctgaacaatttgttgaatgt
atagagtgtggaagaaaaatgcatcagatttgtgtgcttcacaatgagattatctggcca
actggctttgtttgtgatggttgcttaaagaaaactggacgaacccgaagagaaaataaa
ttctgtgctagacggttgccaactacaagacttggtacattcttggagaacagagttaat
gagttcctgagaagacaaaatcatcctgagtcaggcgaagtcatagttagggtggttcat
acttcagaaaaaactgtagaagttaagccaggaatgaaagcaaggtttgtagatagtgga
gagatggcagaacagttcccttatcgaacaaaagccctctttgcttttgaggagattgat
ggtgtagatttgtgcttttttggaatgcacgttcaggaatatgggtcagactgccctcag
cccaaccagagacgagtatacatatcataccttgacagtgttcatttcttccgccctaaa
tgcttgaggactgctgtatatcatgaaatactaataggatacctagaatatgtcaagaag
ttgggatatacaactggacatatctgggcctgcccacctagtgaaggagatgattacatt
ttccattgtcatccacctgaccaaaagatacccaaaccgaaacgactgcaggaatggtac
aaaaagatgttggataaatctgtgtcagagcgcatagtccatgattataaggatattttt
aagcaggcaacagaagaccgtctaacaagtgcaaaagagctgccttactttgagggagat
ttttggccaaatgttctagaagaaagcattaaggagctagaacaagaggaggaggagcgg
aagagagaagagaacactagcaatgagagcactgatgttagcaaaggagatagcaaaaat
gccaaaaagaagaataacaaaaagactagcaaaaataagagtagcttgagccgtggaaat
aaaaagaagcctggaatgcccaatgtctccaatgacctttcccagaaactgtatgccact
atggagaagcacaaggaggtattctttgtgatccgtctcattgctggccctcaagctaat
tcattgcctcccattattgaaccagacccacttattccatgtgacttaatggatgggcgt
gatgccttccttacccttgctagagataaacaccttgagttttcttcactacgaagggca
atgtggtcaactatgtgtatgctggtagagctacacacacagagtcaggaccgatttgtt
tatacctgcaatgagtgcaagcaccatgtggagacaagatggcattgcacagtctgtgag
gattatgacctctgcatcacctgctataacactaaaaaccatgagcacaagatggagaaa
ctgggtcttggtattgatgacgagagcaacaaccaacagacagccaccacgcagagccct
ggggattcccgccgcctgagcatccaacgctgcattcagtctctggtgcatgcctgccag
tgtcgcaatgccaactgctcactgccgtcctgtcagaagatgaaaagggttgtgcagcac
actaaaggctgcaagcgcaaaaccaacggagggtgcccaatttgcaagcagcttattgcc
ctttgctgctaccatgctaagcactgccaggagagcaagtgcccagtgcccttctgcctc
aacatcaaacacaagcttcgtcagcaacagcttcagcaccgtttgcagcaagctcagatg
ctccgcaggaggatggcaagcatgcagaggaccggcatagtaggtcagccgcaggggttg
ccttcaccaacaccagctacgccaacaactcctacaggacagcagccaccaacccctcag
accccgcagccgcagcctccaccccagcctgcctcacagccacagccgcagccgcagcct
cccaataacatgtctccatttaatatttcaagaattcagcctcctggaactgtgtctcaa
ggcaaggccggtgaccaggtaactcctccgacaactcctcagactgctcagccgcctatt
cagggccctcctgcagctgcggtagaaatagccatgcagatacaacgagtagcagatcac
cagcggcagatggctcatgttcctctcttccagaggccaattcaacacccaaaccagatg
gcccaaatgaatccgatacagcccatgagtgttacaccacctcagatggccaggggtccc
ggtggccacatagatcaagggatgggaccaacaggaattcagcaacagccagcttgggcc
cagggagggttgcctcagcctcagcaactgcagcagggaatgcagagacaatcgatgatg
tcaatggcccagcctgggcagccgatcaatatgtccccacagccaggaatgggtcaagta
ccaggtgcagctcagtcgaaagcaagtcctctgccccaggcagccttacaaaacctgctg
cggactctcaggtctcccagctctcccatgcagcagcagcaggtgcttaacatcctgcat
tccaaccctcaactcttagctgctttcatcaagcagcgggctgccaagtatgctgggaac
cagaatccacagggcatgccagggcaacctggaatgcctcaggggcaaccagggctgcag
cagcaacaggctatgccagggcagcaaggtgtgcacccaaatccagccatgcaaaacatg
aatccaatgcaagcaggcattcagaggcccagcatgcctcagcagtcaccacctcagcag
cctccaccccagcaggctatgggtggaatgaatcctcaggcacagccaatgaacatgcag
ttccgggacctcttaatgaggcggcatcaaatgatggagcagcagcgtcagcagcaacaa
cagcagcaaggcgcaggccctgggttgggtcccggcatggccaaccataaccagttccaa
cagccgcagggagttggatacccccaacagcagcagcagcggatgcaacaccacatgcag
cagctgcagcaaggaaacatgggacaaatgagccagcttccacaagcaatgagcgcagaa
acaggatcgagtctgcagcaggctttccagcagcgactactccagcagcagatgggatca
ccagctcagcccaatcccatgagtcctcagcagcacatgctcccaaaccaggcccagtcc
ccacacatacaaggccagcagatcccatcgtcactcaccaaccaagtgcgttcgccacag
cctgtcccctcaccgcggccccagtcccagcctccccactccagcccttcccctcgaatg
caaccacaaccttctccccaccacgtctccccacagaccagctccccacatccaggactg
gtagctgcccaggctaaccccatggatcaagggcactttgccagcccggaccagagtgca
atgctttctcagcttgcaaataatccaggcatggcgggtctccatggtgcaagtgccaca
gaactgggactcagctcagataattcagacttaaactcaaatctttcacagagtacacta
gacatacactaa

DBGET integrated database retrieval system