KEGG   Anolis carolinensis (green anole): 100566814Help
Entry
100566814         CDS       T01608                                 

Gene name
plcg2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04020  Calcium signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04370  VEGF signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04933  AGE-RAGE signaling pathway in diabetic complications
Module
acs_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100566814 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100566814 (plcg2)
   04370 VEGF signaling pathway
    100566814 (plcg2)
   04020 Calcium signaling pathway
    100566814 (plcg2)
   04070 Phosphatidylinositol signaling system
    100566814 (plcg2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100566814 (plcg2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100566814 (plcg2)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100566814 (plcg2)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100566814 (plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100566814 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100566814
NCBI-ProteinID: XP_003223017
Ensembl: ENSACAG00000009200
UniProt: H9GF62
Position
c
AA seq 1263 aa AA seqDB search
MSKRGIDYGELPEYEKSQIKRTLELGTVMTVYSLKKSNPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNAKDFERGKAIRQKDEHCFTIFYGTQFVLNTLSLVADSKDDA
ERWLCGLTILHQEAMNASTPAITESWLRKLIYSVDQSRRNSISLRELKTVLPSVNFKVNN
IKFLKDKFAEIKAVKEELSFEQFHLFYKKIMFEQQKSILDDFKKDSTMFLLGNTDRPDAS
AVHLHDFQRFLLHEQQETWAQDLNKVRERMSKFIDDTMRETDEPFLYVDEFLTYLFSKEN
SIWDDKYDAIDPQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELD
CWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKEHAFVTSEYPVILSIEEHCSVEQQRHIAR
VFREVLGDQLLTKPVEASADQLPSPTQLKEKFIIKHKKLGPKGDVDVNTEDKKEEKKQQG
ELYMWDTIDQKWTRHYCAIAHEKLSFSDDIEQNNEEEPLKDVKCTELHYGEKWFHGKMKE
GRTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDYTLSFWRSGRVQHCRIRSSTDGDIIK
YYLTDNLTFDNICDLVQHYKEAHLRCAEFELRLTDAVPNPKPHENKSWYYSNLSRGEAED
MLMRIPRDGAFLIRKRDEPESYAMTFRAEGKVKHCLIKQEGRLFVLGTSAYFESLVELVN
YYEKHPLYRKMKLRYPVTEELLGRYSMEKDPSSLYDVKMYVEPTEITPSVPLRTVKALYD
YQAKRDDELTFCRGALIHNVLKESSGWWKGDYGCKVQHYFPSNYVEDMSSDNIEDLENQI
IEDNPLGSLCRGIFDLNMYNIAKMPQGKHGRNFVFILEPKNPEDPPVEFAAEKVEELFEW
YQSVREITWRTAEEATIRVYWEKKQLIAMELSDLVVFCIPTSKTKDNLENPNFKEIRSFV
ETKAEAIVKQKPVDLLKYNQKGLTRIYPKGQRVDSSNYDPFRFWFCGVQMVALNFQTPDK
YMQLNHALFSLNGRTGYVLQPESMRNDAYDPVPNESKKKLQMILAVRVIGARHLPKPGRS
IACPFVEVEICGAEYDNNKFKTTVVNDNGLNPIWTSQEPVKFEIYDPSLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGFSEDIELASLLVYCEKQQIPEGEEDLYSSF
RQLRQRQAELNNQLYDTRRNLRSPNRDALLKEFNVNEGQLQVYQETCNRRLKEKRVSNSK
FYS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagaggcatagactatggggaacttccagaatatgagaagagtcaaatcaaa
aggacactggagctggggaccgtcatgacggtgtacagcctgaaaaagagtaacccagag
aggagaacaatccaggtcatcatggaaaccaggcaggtagcatggagtaagacagctgac
aagatagaaggattcttggatttgatggaaataaaggaaatcagaccaggaaaaaatgca
aaggattttgagcgtgggaaagcaatacgacaaaaagatgaacactgtttcactattttc
tatggtactcagtttgttctcaacaccttgagtttagtagctgattccaaggatgatgct
gagaggtggctgtgtggtttgactattttacatcaagaagccatgaatgcttccacacca
gcaattacagagagctggctcagaaagctgatttactcagtggatcaatccagaaggaat
agcatcagccttcgagagctaaaaactgtgcttccatctgtaaacttcaaagtaaacaac
ataaagtttttaaaagataagtttgcagaaataaaggctgttaaagaagaacttagcttt
gagcaattccatctattttacaagaaaattatgtttgagcaacagaaatcgattcttgat
gatttcaagaaagattccactatgtttcttctgggcaacacagatcgtccagatgcttca
gcagtacatttgcatgacttccagaggtttttgctgcatgaacagcaggaaacatgggca
caagatcttaataaagtaagagaacggatgtctaaatttatagatgacaccatgagagaa
actgatgagccttttctatatgttgatgagttccttacttatcttttttcaaaagaaaac
agtatctgggatgacaagtatgatgcaattgaccctcaggacatgaataatcctttgtcc
cactactggatttcttcctcacataatacatacctcacaggagaccagcttcgtagtgaa
tcgtcccctgaagcatatatcaggtgcctccgaatgggatgccggtgtattgagttggat
tgctgggacggtccagatgggaaacccatcatttatcatggatggacacggacaacgaaa
attaaatttgacgatgttgtgcaagccatcaaggagcatgcttttgtcacgtctgagtac
ccagtgattttgtccatcgaggagcactgcagcgtggagcaacaacgccacattgcccga
gtgttcagggaggtgcttggggatcaacttctcaccaaacctgttgaagccagtgctgat
cagctgccctcgccaactcagttgaaggaaaagtttatcatcaagcataaaaaactaggg
ccaaaaggtgatgtagatgtcaatacagaagacaagaaagaagaaaaaaagcaacaagga
gaactctacatgtgggacaccatagaccagaaatggactcgccattattgtgctatagcc
catgaaaagctctcttttagtgatgacattgaacaaaacaatgaagaagaaccattgaag
gacgtgaagtgtacagagctccactatggcgagaaatggttccatgggaaaatgaaagaa
ggaaggacaactgcagaaaagctgctccaggaatattgtgctgaaatgggcggcaaggac
gggacgttcttagtgagagagagcgaagctttccctaatgactacacactgtctttctgg
agatcaggtagagtccagcactgccgcatccgctcctcaactgatggagacatcataaag
tactacctgacagataacctcacgtttgataacatctgtgacctggtccaacattataaa
gaagcacatttgcgttgtgcggagtttgaactgcgcttgactgatgctgtgcctaacccc
aagcctcatgaaaataagagttggtactacagtaacctgagccgtggagaagcagaagat
atgctgatgcgaattcctagggatggagcctttttgataaggaagagagatgaacctgag
tcctatgctatgaccttcagagctgagggaaaggtgaagcactgcctgatcaagcaagaa
ggacgcctgtttgtcttgggaacgtcagcttactttgagagcttagtagagttggtgaac
tattatgagaagcatcctttgtacaggaaaatgaaattgcgctatcctgtaacagaggag
ctgctgggacgctacagcatggagaaagaccctagctcattatatgatgtcaagatgtat
gtggaacccactgaaataacaccttctgtgcctctgagaacggtcaaagccttgtatgac
tatcaagctaaaagagatgatgagctaaccttttgccgcggagccttaattcataacgtc
ttaaaagaaagcagtggctggtggaaaggagattatggatgcaaagttcagcactatttc
ccatccaattatgttgaagacatgtcatctgataacatagaagatcttgaaaaccagata
attgaagacaaccctttagggtctttgtgcagagggatttttgacctcaatatgtataat
attgctaaaatgcctcaaggaaaacatgggaggaattttgtcttcattctggagcccaag
aacccagaggatccgcctgttgagtttgcagctgagaaagtggaagagttatttgagtgg
tatcaaagcgttagggaaatcacatggaggacagccgaagaggcaaccatcagggtatac
tgggagaagaagcagttaattgccatggagttatctgacttggttgtcttctgcatacct
acaagtaaaaccaaggacaacttagaaaatcccaatttcaaagaaatccgttcctttgtg
gagacaaaggcagaagccattgtcaagcagaagcctgttgacctgctcaaatacaaccag
aagggactgacacgcatctaccccaaaggccagagagtggactcttccaattacgaccct
ttccggttctggttttgtggggtgcagatggtggctctaaatttccagacaccagataaa
tacatgcaactgaatcacgccttgttttcacttaatggccggactggatatgtactgcaa
ccagaaagtatgaggaacgatgcgtatgatccagtaccaaatgaatcaaagaagaaactt
cagatgattttggctgtgagggttattggtgctcgccatcttcccaaacctggtagaagc
attgcctgtccatttgtggaagtggaaatttgtggggctgaatatgacaacaataaattt
aagaccactgttgtgaatgacaatggccttaatcccatttggacatcccaggaaccagtg
aagtttgaaatttatgacccaagccttgcctttctgcgctttgtggtctatgaagaagac
atgtttagtgatcccaacttcttagcacatgccacatttcctatcaaaggaatcaaatca
ggctttcgatcagttcctctcaaaaatggcttcagtgaagatatagagctggcttccctt
ctggtttattgtgagaagcagcagatcccagaaggtgaagaagacctctattcgtcgttt
cggcaacttcggcaacgacaagcggagctgaacaatcagttatatgacacccgacgcaat
ttaaggagtccaaatcgtgatgctttattgaaagagttcaatgtgaatgagggtcagctg
caggtgtatcaagagacttgcaacaggagattgaaggagaaaagggtcagcaatagcaaa
ttctactcatag

DBGET integrated database retrieval system