KEGG   Anolis carolinensis (green anole): 100566814Help
Entry
100566814         CDS       T01608                                 

Gene name
plcg2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100566814 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100566814 (plcg2)
   04370 VEGF signaling pathway
    100566814 (plcg2)
   04020 Calcium signaling pathway
    100566814 (plcg2)
   04070 Phosphatidylinositol signaling system
    100566814 (plcg2)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100566814 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C
AA seq 1263 aa AA seqDB search
MSKRGIDYGELPEYEKSQIKRTLELGTVMTVYSLKKSNPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNAKDFERGKAIRQKDEHCFTIFYGTQFVLNTLSLVADSKDDA
ERWLCGLTILHQEAMNASTPAITESWLRKLIYSVDQSRRNSISLRELKTVLPSVNFKVNN
IKFLKDKFAEIKAVKEELSFEQFHLFYKKIMFEQQKSILDDFKKDSTMFLLGNTDRPDAS
AVHLHDFQRFLLHEQQETWAQDLNKVRERMSKFIDDTMRETDEPFLYVDEFLTYLFSKEN
SIWDDKYDAIDPQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELD
CWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKEHAFVTSEYPVILSIEEHCSVEQQRHIAR
VFREVLGDQLLTKPVEASADQLPSPTQLKEKFIIKHKKLGPKGDVDVNTEDKKEEKKQQG
ELYMWDTIDQKWTRHYCAIAHEKLSFSDDIEQNNEEEPLKDVKCTELHYGEKWFHGKMKE
GRTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDYTLSFWRSGRVQHCRIRSSTDGDIIK
YYLTDNLTFDNICDLVQHYKEAHLRCAEFELRLTDAVPNPKPHENKSWYYSNLSRGEAED
MLMRIPRDGAFLIRKRDEPESYAMTFRAEGKVKHCLIKQEGRLFVLGTSAYFESLVELVN
YYEKHPLYRKMKLRYPVTEELLGRYSMEKDPSSLYDVKMYVEPTEITPSVPLRTVKALYD
YQAKRDDELTFCRGALIHNVLKESSGWWKGDYGCKVQHYFPSNYVEDMSSDNIEDLENQI
IEDNPLGSLCRGIFDLNMYNIAKMPQGKHGRNFVFILEPKNPEDPPVEFAAEKVEELFEW
YQSVREITWRTAEEATIRVYWEKKQLIAMELSDLVVFCIPTSKTKDNLENPNFKEIRSFV
ETKAEAIVKQKPVDLLKYNQKGLTRIYPKGQRVDSSNYDPFRFWFCGVQMVALNFQTPDK
YMQLNHALFSLNGRTGYVLQPESMRNDAYDPVPNESKKKLQMILAVRVIGARHLPKPGRS
IACPFVEVEICGAEYDNNKFKTTVVNDNGLNPIWTSQEPVKFEIYDPSLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGFSEDIELASLLVYCEKQQIPEGEEDLYSSF
RQLRQRQAELNNQLYDTRRNLRSPNRDALLKEFNVNEGQLQVYQETCNRRLKEKRVSNSK
FYS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagaggcatagactatggggaacttccagaatatgagaagagtcaaatcaaa
aggacactggagctggggaccgtcatgacggtgtacagcctgaaaaagagtaacccagag
aggagaacaatccaggtcatcatggaaaccaggcaggtagcatggagtaagacagctgac
aagatagaaggattcttggatttgatggaaataaaggaaatcagaccaggaaaaaatgca
aaggattttgagcgtgggaaagcaatacgacaaaaagatgaacactgtttcactattttc
tatggtactcagtttgttctcaacaccttgagtttagtagctgattccaaggatgatgct
gagaggtggctgtgtggtttgactattttacatcaagaagccatgaatgcttccacacca
gcaattacagagagctggctcagaaagctgatttactcagtggatcaatccagaaggaat
agcatcagccttcgagagctaaaaactgtgcttccatctgtaaacttcaaagtaaacaac
ataaagtttttaaaagataagtttgcagaaataaaggctgttaaagaagaacttagcttt
gagcaattccatctattttacaagaaaattatgtttgagcaacagaaatcgattcttgat
gatttcaagaaagattccactatgtttcttctgggcaacacagatcgtccagatgcttca
gcagtacatttgcatgacttccagaggtttttgctgcatgaacagcaggaaacatgggca
caagatcttaataaagtaagagaacggatgtctaaatttatagatgacaccatgagagaa
actgatgagccttttctatatgttgatgagttccttacttatcttttttcaaaagaaaac
agtatctgggatgacaagtatgatgcaattgaccctcaggacatgaataatcctttgtcc
cactactggatttcttcctcacataatacatacctcacaggagaccagcttcgtagtgaa
tcgtcccctgaagcatatatcaggtgcctccgaatgggatgccggtgtattgagttggat
tgctgggacggtccagatgggaaacccatcatttatcatggatggacacggacaacgaaa
attaaatttgacgatgttgtgcaagccatcaaggagcatgcttttgtcacgtctgagtac
ccagtgattttgtccatcgaggagcactgcagcgtggagcaacaacgccacattgcccga
gtgttcagggaggtgcttggggatcaacttctcaccaaacctgttgaagccagtgctgat
cagctgccctcgccaactcagttgaaggaaaagtttatcatcaagcataaaaaactaggg
ccaaaaggtgatgtagatgtcaatacagaagacaagaaagaagaaaaaaagcaacaagga
gaactctacatgtgggacaccatagaccagaaatggactcgccattattgtgctatagcc
catgaaaagctctcttttagtgatgacattgaacaaaacaatgaagaagaaccattgaag
gacgtgaagtgtacagagctccactatggcgagaaatggttccatgggaaaatgaaagaa
ggaaggacaactgcagaaaagctgctccaggaatattgtgctgaaatgggcggcaaggac
gggacgttcttagtgagagagagcgaagctttccctaatgactacacactgtctttctgg
agatcaggtagagtccagcactgccgcatccgctcctcaactgatggagacatcataaag
tactacctgacagataacctcacgtttgataacatctgtgacctggtccaacattataaa
gaagcacatttgcgttgtgcggagtttgaactgcgcttgactgatgctgtgcctaacccc
aagcctcatgaaaataagagttggtactacagtaacctgagccgtggagaagcagaagat
atgctgatgcgaattcctagggatggagcctttttgataaggaagagagatgaacctgag
tcctatgctatgaccttcagagctgagggaaaggtgaagcactgcctgatcaagcaagaa
ggacgcctgtttgtcttgggaacgtcagcttactttgagagcttagtagagttggtgaac
tattatgagaagcatcctttgtacaggaaaatgaaattgcgctatcctgtaacagaggag
ctgctgggacgctacagcatggagaaagaccctagctcattatatgatgtcaagatgtat
gtggaacccactgaaataacaccttctgtgcctctgagaacggtcaaagccttgtatgac
tatcaagctaaaagagatgatgagctaaccttttgccgcggagccttaattcataacgtc
ttaaaagaaagcagtggctggtggaaaggagattatggatgcaaagttcagcactatttc
ccatccaattatgttgaagacatgtcatctgataacatagaagatcttgaaaaccagata
attgaagacaaccctttagggtctttgtgcagagggatttttgacctcaatatgtataat
attgctaaaatgcctcaaggaaaacatgggaggaattttgtcttcattctggagcccaag
aacccagaggatccgcctgttgagtttgcagctgagaaagtggaagagttatttgagtgg
tatcaaagcgttagggaaatcacatggaggacagccgaagaggcaaccatcagggtatac
tgggagaagaagcagttaattgccatggagttatctgacttggttgtcttctgcatacct
acaagtaaaaccaaggacaacttagaaaatcccaatttcaaagaaatccgttcctttgtg
gagacaaaggcagaagccattgtcaagcagaagcctgttgacctgctcaaatacaaccag
aagggactgacacgcatctaccccaaaggccagagagtggactcttccaattacgaccct
ttccggttctggttttgtggggtgcagatggtggctctaaatttccagacaccagataaa
tacatgcaactgaatcacgccttgttttcacttaatggccggactggatatgtactgcaa
ccagaaagtatgaggaacgatgcgtatgatccagtaccaaatgaatcaaagaagaaactt
cagatgattttggctgtgagggttattggtgctcgccatcttcccaaacctggtagaagc
attgcctgtccatttgtggaagtggaaatttgtggggctgaatatgacaacaataaattt
aagaccactgttgtgaatgacaatggccttaatcccatttggacatcccaggaaccagtg
aagtttgaaatttatgacccaagccttgcctttctgcgctttgtggtctatgaagaagac
atgtttagtgatcccaacttcttagcacatgccacatttcctatcaaaggaatcaaatca
ggctttcgatcagttcctctcaaaaatggcttcagtgaagatatagagctggcttccctt
ctggtttattgtgagaagcagcagatcccagaaggtgaagaagacctctattcgtcgttt
cggcaacttcggcaacgacaagcggagctgaacaatcagttatatgacacccgacgcaat
ttaaggagtccaaatcgtgatgctttattgaaagagttcaatgtgaatgagggtcagctg
caggtgtatcaagagacttgcaacaggagattgaaggagaaaagggtcagcaatagcaaa
ttctactcatag

DBGET integrated database retrieval system