KEGG   Anolis carolinensis (green anole): 100566843Help
Entry
100566843         CDS       T01608                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:acs00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MGRRPTRPSCPAFRLREVAAMYLSSLAVFLLILVVALQGTDPREDYFPYKVPLDPQSTLE
LSWNVSYLHREVHFQILVKKLQDGLLFGMSDRGGFEDADLAVLWSDGVQSYFADAWSDHD
GHLHMDSQQNYKLLKAWSALEGFYLLFKRSFDTCDPKDYRIEDGTVHLIYGILEAPVPSL
GAINVSALRRKGLQRVQLLKPDIRIPSLPSDLKTMVIRAPNVSIPGQETTYWCYMTELPD
GFGKHHIVMVGHHDSSGIRLFYTASLRPYDAGIMELGLVYTPVMAIPPGESHFGLTGYCT
ETCTQVALPPSGIHIFASQLHTHLTGRSVETVLSRGGQEKEIVNKDPHYSPHFQEIRMLK
KVVSVFPGDVLRTTCIYNTEDRSQATVGGFGIMEEMCVNYVHYYPQTELELCKSAIDLGY
LQRYFKLVNRFNDEEVCTCPEASVTQQFASVPWNSLSRDVLKSLYGFAPISMHCNKSSAV
RFP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggcggccgacgaggccttcctgcccggcgttccgtctccgagaagtggccgcc
atgtatctcagctccctggccgtcttcctcctcatcctggtggtcgctctccaaggcacg
gacccaagggaggactacttcccttacaaagtcccattggaccctcaaagcaccttggag
ctctcgtggaacgtcagctacctccaccgagaggtccatttccagattttggtcaagaag
ctccaagacgggctgctctttgggatgtcggaccggggaggttttgaggatgcggacctg
gccgtgctctggagcgacggcgtccagtcttattttgcggacgcctggagtgaccatgat
ggacacctgcacatggactcccagcagaactacaagctcctgaaagcatggtctgccctc
gaagggttctacttgctcttcaaacggtcctttgatacctgcgacccaaaggactatcgg
atagaggatggcaccgtgcatctcatctatgggattctggaggcacccgtcccttccctt
ggggcgattaatgtttccgccctccgccggaaagggctacaaagggtccagctgctgaaa
ccggacatcaggattccttcattgccgagcgacttgaagaccatggtgatcagggccccg
aacgtgagcatcccaggccaagagacgacctattggtgctacatgacagagcttccagat
ggtttcggaaagcatcacattgtcatggtaggccaccatgattcctcagggatccggctc
ttttacaccgcctcccttcgtccctacgatgctggcatcatggaactcggcttggtgtac
accccggtgatggcaatcccgcctggagaaagccatttcggactgacgggatactgcacc
gaaacatgcacccaggtggccctgcccccttccgggatccacattttcgcctctcagctt
catacccacctgactgggaggagcgtggagaccgtcttatcaagaggaggccaggagaaa
gagatcgtcaacaaggacccccactatagcccccacttccaggagatccgcatgttgaag
aaagtggtgtctgtgtttccgggcgatgtgctgagaaccacttgcatctacaacaccgaa
gacaggagtcaagccactgtgggaggctttggaatcatggaagagatgtgtgtgaattac
gtccattattatccccagacggagctggagctgtgcaagagcgccattgacttgggctac
cttcagcgctattttaagcttgtcaacaggtttaatgatgaggaagtctgcacatgccca
gaggcctccgtcacgcagcagtttgcctcggtgccttggaattcactcagcagagatgtc
ttgaaatccctgtatggatttgctcccatttcgatgcattgtaataagtcttcagcagtc
cgtttcccg

DBGET integrated database retrieval system