KEGG   Anolis carolinensis (green anole): 100566843Help
Entry
100566843         CDS       T01608                                 

Gene name
dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100566843 (dbh)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100566843 (dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 553 aa AA seqDB search
MPSFPKSDKTKDGHVSVPFAFGRTQSMGRRPTRPSCPAFRLREVAAMYLSSLAVFLLILV
VALQGTDPREDYFPYKVPLDPQSTLELSWNVSYLHREVHFQILVKKLQDGLLFGMSDRGG
FEDADLAVLWSDGVQSYFADAWSDHDGHLHMDSQQNYKLLKAWSALEGFYLLFKRSFDTC
DPKDYRIEDGTVHLIYGILEAPVPSLGAINVSALRRKGLQRVQLLKPDIRIPSLPSDLKT
MVIRAPNVSIPGQETTYWCYMTELPDGFGKHHIVMVGHHDSSGIRLFYTASLRPYDAGIM
ELGLVYTPVMAIPPGESHFGLTGYCTETCTQVALPPSGIHIFASQLHTHLTGRSVETVLS
RGGQEKEIVNKDPHYSPHFQEIRMLKKVVSVFPGDVLRTTCIYNTEDRSQATVGGFGIME
EMCVNYVHYYPQTELELCKSAIDLGYLQRYFKLVNRFNDEEVCTCPEASVTQQFASVPWN
SLSRDVLKSLYGFAPISMHCNKSSAVRFPGEWERQTLPKVTEVLPEPASPCEHNGPHFPA
SPTIVKLDKEASK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgtttcccaaaagcgacaagaccaaagacggccacgtttccgtcccttttgcg
tttggcaggacgcaaagcatgggaaggcggccgacgaggccttcctgcccggcgttccgt
ctccgagaagtggccgccatgtatctcagctccctggccgtcttcctcctcatcctggtg
gtcgctctccaaggcacggacccaagggaggactacttcccttacaaagtcccattggac
cctcaaagcaccttggagctctcgtggaacgtcagctacctccaccgagaggtccatttc
cagattttggtcaagaagctccaagacgggctgctctttgggatgtcggaccggggaggt
tttgaggatgcggacctggccgtgctctggagcgacggcgtccagtcttattttgcggac
gcctggagtgaccatgatggacacctgcacatggactcccagcagaactacaagctcctg
aaagcatggtctgccctcgaagggttctacttgctcttcaaacggtcctttgatacctgc
gacccaaaggactatcggatagaggatggcaccgtgcatctcatctatgggattctggag
gcacccgtcccttcccttggggcgattaatgtttccgccctccgccggaaagggctacaa
agggtccagctgctgaaaccggacatcaggattccttcattgccgagcgacttgaagacc
atggtgatcagggccccgaacgtgagcatcccaggccaagagacgacctattggtgctac
atgacagagcttccagatggtttcggaaagcatcacattgtcatggtaggccaccatgat
tcctcagggatccggctcttttacaccgcctcccttcgtccctacgatgctggcatcatg
gaactcggcttggtgtacaccccggtgatggcaatcccgcctggagaaagccatttcgga
ctgacgggatactgcaccgaaacatgcacccaggtggccctgcccccttccgggatccac
attttcgcctctcagcttcatacccacctgactgggaggagcgtggagaccgtcttatca
agaggaggccaggagaaagagatcgtcaacaaggacccccactatagcccccacttccag
gagatccgcatgttgaagaaagtggtgtctgtgtttccgggcgatgtgctgagaaccact
tgcatctacaacaccgaagacaggagtcaagccactgtgggaggctttggaatcatggaa
gagatgtgtgtgaattacgtccattattatccccagacggagctggagctgtgcaagagc
gccattgacttgggctaccttcagcgctattttaagcttgtcaacaggtttaatgatgag
gaagtctgcacatgcccagaggcctccgtcacgcagcagtttgcctcggtgccttggaat
tcactcagcagagatgtcttgaaatccctgtatggatttgctcccatttcgatgcattgt
aataagtcttcagcagtccgtttcccgggagaatgggagagacaaacgttgccaaaagtt
acggaggtacttccggagccggcctcaccctgtgaacacaatggaccccacttcccagca
tcccccaccattgtaaagcttgacaaagaagcgtcaaaataa

DBGET integrated database retrieval system