KEGG   Anolis carolinensis (green anole): 100566852Help
Entry
100566852         CDS       T01608                                 

Gene name
acacb
Definition
acetyl-CoA carboxylase 2
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100566852 (acacb)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100566852 (acacb)
   00640 Propanoate metabolism
    100566852 (acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100566852 (acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100566852 (acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100566852 (acacb)
Enzymes [BR:acs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100566852 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100566852 (acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2364 aa AA seqDB search
MLLPLVVLAILLLCWAWSKMAERPPSLPLSETPLAQTRDDPKEAPSEPTAAPVCQDKSLL
PGPDPQGQKGALAKFVLGSFEDNSSDEEEMAAQRQRSNLASDRSASSMNLALEVGLPMRP
SMSLGRRMERRGGRDLPPRDLVAVASPAEFLTRFGGKRLLQKVLIANNGIAAVKCMRSIR
RWSYEMFRNERAIRFVVMVAPEDLKANAEYIKMADQYVPVPGGSNNNNYANVELIVDIAR
RIPVQAVWAGWGHASENPKLPELLHKHGIAFLGPSSEAMWSLGDKVASTIVAQTLQVPTL
PWSGSGLVAEWTSSEEDEGPTKTLFVPPETYRKACVKDVEEGLEAAKRIGFPVVIKASEG
GGGKGIRVAEAAEGFPVRFRQVQSEAPGSPLFVMSFLPHSRHLEVQVLADQYGNALSLFT
RDGSLQRRHQKIIEEAPASVAPPSAFRCMEQWAVRLAKSGGFVGAGTVEYLYAEGGAPYF
LELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRTLYGEPPWDDTPISFDNP
STVPVPRGHVIAARITSENPEEGFKPSSGTVQELNFRSSRDVWGYFSVAAAGGLHEFADS
QFGHCFSWGEDREEAIANLVVALKELSIRGDFQTTVEYLVKLLETEAFRANEVDTSWLDH
LIAGNVQAEKPDTMLGVVCGALNVADAAFRTSRDDFLHSLERGQVLPATSLLNLVDVELI
SDGIKYALKVARQSLSTYVVLMNGSLLEVDVHRLNDGGLLLSFGGSSHTTYMQEDLGRYR
ITVGNQTCDFEKENDPTLLRSSSAGKLLQYTVDDGSHVCAGHSYAEMEVMKMVVTLSVED
SGVIHYLKRPGTLLEPECVIAKLELDNPSKVHPAQLYTGSLPPQQPLPLLGGNPHQVFRN
VLDSLVNVLNGYCLPEPYFSAKVQDWVGTLMQTLRDPSLPLLELQELMTSLSGRLPPSVE
KAIRTAMAQYASNATSVLCQFPSQQIASILDSHAATLQRKTDREAFFMDTQSIVQLVQRY
RSGIRGHMKSVVLDLLRRYLQVESEFQQAHYEKSVMRLRERHLRDLAPVLGCLFSHSQVA
HKNRLVVSLIEQLWGRDPTLTEELEAILNELTQLHRAENAKVALRARQVLIASHLPSYEL
RLNQVESIFLSAIDLYGHQFCPENLKKLIFSETTIFDVLPTFFYHDKPVVCMAALEVYVR
RAYVAYELQGLQHRPLTDGTCLLQFQFRLPSSHPNRVCVPMGLSNPNLSRHSTELFMDSG
FSPLSQRMGAMVAFDRFQDFTRNFDEVISCFADPPSEGPLFRDARATCYNEEDEEEDQKN
LREEPIHILNVALRFVDQGEDEELVPIFRSFAQSKNNILMDYGLRRITFLIMQQREFPKF
FTFRARDKFAEDRIYRHLEPALAFQLELSRMRHFHLQALPCANHKMHLYLGTARVRARPE
STDQRLFVRAIVRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNDKGYRTDCNHIFL
NFVPTVVMDPAKIEESVRSMVMRYGRRLWRLRVLQAEVKINIRRSPSDPALPVRLFLTDE
SGYRLDISLYREVYDPSTGSIMFHSFGEKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGT
TYVYDFLEMIRQALFKLWGSSESCPAEVLTFTELVLDSQGKLMQMNRLPGGNEIGMVAFK
MDLRTPEYPTGREVVFIVNDITYKMGSFGPEEDLLFLRASELARAEGIPRIYVAANSGAR
IGFAEEVKHKFQVAWVDPADPYKGFRYLYLTPQDYTKISSSNLVHCKHVEEAGESRYILT
DIIGKDEGFGVENLRAAAAIAGESSLAYDEIVTISMVTCRAIGIGAYLVRLGQRVIQVEN
SHIILTGAGALNKVLGREVYTSSNQLGGVEIMHNNGVSHVAVPDDFEGVYTILQWLSYMP
KDNHSPLPIMPPTDPIEREIEFFPSKCPYNPRWMLAGRPHPTTKGLWQSGFFDHGSFSEI
MQPWAQTVVVGRARLGGIPVGVIAVETRTVELAVPADPANPESEAKVIQQAGQVWFPDSA
FKTAQAIRDFDRERLPLLVFANWRGFSGGMKDMYDQVLKFGAYIVDSLRQFKQPALVYIP
PHSELRGGSWVVIDPTINPLHMELYADRDSRGGILEAEGTVEIKFRKKDLVKTMRRVDEA
CASIAQRLGAPDLPKEKRRDLEMQLQAREEHLLPIYHQVAVQFADLHDTPGRMQEKGVIT
DILQWKTARSFFYWRLRRLLLEEVVKADILSANHELSNSHIQSMLRRWFLETEGTVKGYL
WDNNQVVVEWLEKHLKEEDGAKSAIRDNIKYLKRDYALKHIRNLVQANPEVTMDCIIHMT
QDLSRAQRTQVVRLLATMDNPTSS
NT seq 7095 nt NT seq  +upstreamnt  +downstreamnt
atgctacttcctctagttgtcttggccatccttctgctctgctgggcttggtccaagatg
gcagagcgtcctccttcgttgccactgtcggaaaccccattggcgcagaccagggacgac
cccaaggaagccccctctgagccaacggcggcccccgtttgccaagacaagtccctgctt
cccggtccggaccctcagggtcagaagggggccctggccaagttcgtgctgggctccttc
gaggacaactcctcggatgaagaagaaatggcagcccaaaggcagaggagcaacttggcc
agcgatcggtccgcctcctccatgaatttggctttggaggtcggcctccccatgaggccc
agcatgtctttgggacggcgaatggagcgaaggggtggccgagaccttcctcccagggac
ttggtggcggtggcctctccagctgagttcctcacccgcttcggggggaagcgcctcctc
caaaaggtgctgattgccaacaacggcattgcagccgtgaagtgcatgcgctccatccgg
cgctggtcctatgaaatgttccggaacgagagggccatccgctttgtggtcatggtagcc
cccgaggacctcaaggccaacgcagagtacatcaagatggctgaccaatatgtccctgtc
cccggagggagcaacaacaacaattacgccaatgtggagctcatcgtggacatcgccagg
cgcatcccagtccaggccgtttgggctggatggggccacgcttccgaaaaccccaaacta
cccgaattgttgcacaaacatgggattgccttcctaggtccatccagtgaagccatgtgg
tctttaggggacaaagtggcctccaccattgtggcccagaccctccaggtgcccacccta
ccatggagcggaagcggtttggtggcagaatggacttcttcggaggaagatgaaggtccg
acaaagaccctctttgtcccaccagaaacatatagaaaggcctgcgtgaaggatgttgag
gaaggcctggaggccgccaagaggatcggcttcccggtcgtgatcaaggcctcggaagga
ggaggcgggaaagggatccgggtggcagaagcggccgaaggtttccctgttcgattccga
caggtccaaagtgaggctccggggtcccccttgtttgtgatgagtttcctgcctcattcc
cgccacttagaggtccaggtcctggccgaccagtatggcaacgccctctccttattcacc
cgagatggctccctccaacggcggcaccagaagatcattgaagaggcccccgcctccgtg
gccccgccatccgccttccgctgcatggagcagtgggcagtgcgcctggccaagagcggg
ggcttcgtgggggccgggacggtggagtacctctatgcagaaggaggagctccttacttc
ctggagctgaacccccgcctccaggtggagcacccttgcactgagatggtagccgacgtc
aacctcccggcagcacaactccagatcgcgatggggatccctctgcaccggatcaaggac
atccgcactctctatggggagcccccctgggatgataccccaatatcctttgataacccc
agcaccgtcccagtgcccaggggccatgtgattgctgcccggatcactagcgagaatcca
gaggagggcttcaagcccagctctgggacggtgcaggagctgaactttcgcagcagccgg
gacgtctggggatacttcagtgtggcggccgccggggggcttcacgaattcgccgactcc
cagtttggacactgcttctcctggggagaggaccgggaggaggccattgcgaacctggtg
gtggccctgaaggaactctccatccggggggacttccagaccaccgtcgagtatttggtc
aagctgttggagacagaggccttcagggctaacgaggtcgatactagttggctagaccac
ctcattgcagggaacgtccaggcagaaaagccggacaccatgctgggagtggtttgtggg
gcattaaatgtggccgacgctgccttccggaccagcagagacgacttcttgcattccctc
gaaaggggccaagtgctgccagccacttccctcctgaaccttgttgacgtggagctcatt
tccgatggcattaaatatgccctgaaggtggcgcgccagtctctgagcacctatgtggtc
ctgatgaacggctccctcctggaggtggatgtccaccggctcaatgatggtgggctcctt
ctctcctttggtgggagcagccacaccacctacatgcaggaggacctgggcaggtaccgc
atcactgttggcaatcagacctgtgactttgagaaggagaatgacccaacgctactccgc
tcttcttctgccgggaagcttctgcaatacactgtggacgatgggagccatgtttgtgct
ggacatagctatgcagaaatggaggtcatgaagatggtggtgaccctctccgtggaggac
tctggggtcattcattacctgaaacgtcctgggaccctactggagcccgaatgtgtcatc
gccaagctggaactggacaaccccagcaaagttcacccagcccagctttacaccggaagc
ctccctccacagcaacccctgcccctcctcggggggaatccccaccaggtctttcggaac
gtcttggacagccttgtgaatgtcctgaatgggtactgtttgccggagccctacttcagc
gccaaggtccaggactgggtcgggacgctgatgcagaccctgcgggacccctccctgccc
ctcctggagctgcaggagctcatgaccagcctctcaggtcgcttgccgccttctgtggag
aaggccatacggacagccatggcccagtatgccagcaacgccacctccgtcctctgccag
ttccccagccagcagatcgccagtatcctggacagtcatgctgcaacattgcaacgcaag
actgaccgggaggccttcttcatggacactcagagcatcgtccaactggtccagaggtac
cgcagtgggatccggggccacatgaagtcggtggtcttggacctcttgaggcgctacttg
caggtggagtccgagttccagcaagcccattacgagaagagtgtgatgcgcctgcgggag
cgccacctgcgggacctggccccggtcctgggctgcctcttctcccactctcaagtggcc
cacaagaaccgcctggtggtcagcctcatcgagcagctctggggccgggacccgactctg
acagaggagctggaggccatcttgaacgaactgacccagctgcatcgggcggagaatgcc
aaggtggccctcagggccaggcaggtgttgattgcgtcccacctgccgtcctatgaactg
aggctcaaccaggtggagtccatcttcctctcagccattgatttgtatgggcaccagttc
tgccccgaaaacctgaagaagttgatcttttcagaaaccaccatctttgacgtcttgcct
actttcttctatcacgacaagcccgtggtctgcatggcagcattggaggtttatgtgcgg
agggcctacgtggcctatgagctgcaaggcctgcagcatcgcccattgactgacggcacc
tgccttctgcagttccagttcagactgccctcctcccaccccaacagggtgtgtgtccca
atggggctctcgaacccgaacctgtcccgccacagcactgagctcttcatggacagcggc
ttctcccctctttcccagcgaatgggtgccatggtggcctttgaccgcttccaggacttc
accaggaacttcgatgaggtcatttcctgttttgcggacccgccctcggaggggcccctc
ttccgagatgccagggccacctgttacaatgaggaagatgaagaagaggatcagaagaat
ctccgggaggagcccatccacattctgaatgttgccctccgttttgtggatcaaggcgaa
gatgaggagctggtgcccatcttccgttccttcgcacagtccaagaacaatatcctcatg
gattatgggctccggagaatcacatttttgatcatgcagcaaagggagtttcccaagttt
ttcaccttccgggcccgagacaagtttgctgaggaccgcatctaccggcacctggaacct
gccttggccttccagctggagctgagccgcatgcgccacttccacctgcaggccttgcct
tgtgccaaccacaagatgcacctctacctggggaccgccagggtcagggcccgccctgag
agcactgaccagcgcctcttcgtccgtgccatcgtccgacactcggacctcatcaccaag
gaggcctcctttgagtacctgcagaatgaaggagagcgcctattgttagaggccatggat
gagctggaggtagccttcaatgacaaaggctaccgcactgactgcaaccacatctttctc
aacttcgtccccaccgtcgtcatggatcccgccaagatcgaggagtctgtgcgctcgatg
gtgatgcgctatgggcgccgtctgtggcggctgcgtgtccttcaggccgaggtcaagatc
aacatccgccgatcaccctctgaccctgccctccctgttcgcctattcctcaccgacgaa
tccgggtaccgcctggacatcagcctgtacagggaggtctacgaccccagcactggaagc
atcatgttccattcctttggggaaaagcagggacccctgcacgggatgctcatcaacaca
ccgtacgtcaccaaggatctgctccagtccaagcgcttccaggcccagtccctgggcacc
acctatgtctacgacttcctggaaatgatccggcaggctctgttcaagttatggggttcc
tcagagtcttgtcctgcggaggtcttgacctttacggagctagtgctggactcccagggc
aaactgatgcagatgaatcgccttcctggtggaaacgagatcgggatggtggccttcaag
atggatctgaggactcccgaataccccacgggccgcgaggtggtgttcattgtcaacgac
atcacctacaagatggggtcgttcggtcctgaggaggacctgctcttcctgcgcgcctca
gagctagccagggctgagggcatccccaggatctatgtggccgccaacagtggagcccgt
attgggtttgctgaggaggtcaagcacaagttccaagtggcctgggttgaccccgcagac
ccctacaagggattcagatatctgtacctgaccccccaggactacaccaagatcagttcc
tcaaacttggtgcattgcaaacatgtggaggaggctggcgagtccaggtacatcctcact
gacataatcggcaaagatgagggctttggggtggagaacctcagggcagcggcggccatc
gcaggggagtcgtccctcgcctatgatgaaatcgtcaccattagcatggtcacctgccgc
gccattgggattggggcctatttggtgaggcttggccagcgagtcattcaggtggaaaac
tcccatatcatactgacaggagctggagctctgaataaggtcttggggagggaagtctac
acttccagcaaccaactgggaggagtggaaatcatgcacaacaatggcgtctcccacgtt
gccgtccctgacgatttcgaaggtgtctacaccatcctgcaatggctctcctatatgcca
aaggacaatcacagcccattacccatcatgccacccactgaccccattgagagagagatt
gagtttttcccttccaaatgtccctataatccccgatggatgctggctgggaggcctcac
cccacaacaaagggattgtggcaaagtggcttctttgaccatggctccttctcggaaatc
atgcagccttgggcccagacggtggtggtcggccgagccaggttgggagggatcccagtt
ggggtaattgctgtggaaacaaggacagtggagctggcagtccctgctgaccccgcgaat
cctgagtcggaagcaaaggtcatccagcaagctggacaggtctggttcccggattcggcc
ttcaagacggcccaggctattagggactttgatcgtgagcgcctcccgctcttagtattt
gctaactggaggggcttctccggagggatgaaagatatgtatgaccaggtgctgaagttt
ggggcctacattgtggacagcctgcggcagttcaagcagccggccctggtctacattccg
ccgcacagcgagctacggggcggctcctgggtagtcattgatcccaccatcaacccgctg
cacatggagctctatgccgacagggatagccggggtggcatcctggaggcggagggcaca
gtggagatcaagttccgcaagaaagacctggtcaaaaccatgcggagagtcgatgaggcc
tgtgccagcatcgctcagaggctgggtgcaccggatctccccaaagagaagcgccgagat
ttggagatgcagctgcaggcgagggaggagcaccttctcccgatctaccaccaggtggca
gtacagttcgccgacctccatgacactccagggcgcatgcaagagaagggggtcatcacg
gatatcctccagtggaaaacggcccggagcttcttctactggcgtctgcggcgtctcctg
ctggaggaagtggtcaaggcggacatcctcagcgccaaccacgagctcagcaacagccac
atccagtccatgctgcgccggtggttcctggagacggaagggacagtcaagggctacctc
tgggacaacaaccaggtggtggtggaatggctagagaaacatctgaaggaggaagacggg
gccaagtctgccatccgggacaacatcaaatacttgaagcgggactacgccctcaagcac
atccggaacttggtccaagccaaccccgaggtgaccatggactgcatcatccacatgacc
caggatctctcgagagcccagcggacccaagttgttcggcttttagccaccatggacaac
ccaacttcctcttga

DBGET integrated database retrieval system