KEGG   Anolis carolinensis (green anole): 100566852Help
Entry
100566852         CDS       T01608                                 

Gene name
acacb
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:acs01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:acs00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acs00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:acs00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:acs04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2144 aa AA seqDB search
MFGQVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVAPEDLKANAEYIKMADQYV
PVPGGSNNNNYANVELIVDIARRIPVQAVWAGWGHASENPKLPELLHKHGIAFLGPSSEA
MWSLGDKVASTIVAQTLQVPTLPWSGSGLVAEWTSSEEDEGPTKTLFVPPETYRKACVKD
VEEGLEAAKRIGFPVVIKASEGGGGKGIRVAEAAEGFPVRFRQVQSEAPGSPLFVMSFLP
HSRHLEVQVLADQYGNALSLFTRDGSLQRRHQKIIEEAPASVAPPSAFRCMEQWAVRLAK
SGGFVGAGTVEYLYAEGGAPYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRI
KDIRTLYGEPPWDDTPISFDNPSTVPVPRGHVIAARITSENPEEGFKPSSGTVQELNFRS
SRDVWGYFSVAAAGGLHEFADSQFGHCFSWGEDREEAIANLVVALKELSIRGDFQTTVEY
LVKLLETEAFRANEVDTSWLDHLIAGNVQVARQSLSTYVVLMNGSLLEVDVHRLNDGGLL
LSFGGSSHTTYMQEDLGRYRITVGNQTCDFEKENDPTLLRSSSAGKLLQYTVDDGSHVCA
GHSYAEMEVMKMVVTLSVEDSGVIHYLKRPGTLLEPECVIAKLELDNPSKVHPAQLYTGS
LPPQQPLPLLGGNPHQVFRNVLDSLVNVLNGYCLPEPYFSAKVQDWVGTLMQTLRDPSLP
LLELQELMTSLSGRLPPSVEKAIRTAMAQYASNATSVLCQFPSQQIASILDSHAATLQRK
TDREAFFMDTQSIVQLVQRYRSGIRGHMKSVVLDLLRRYLQVESEFQQAHYEKSVMRLRE
RHLRDLAPVLGCLFSHSQVAHKNRLVVSLIEQLWGRDPTLTEELEAILNELTQLHRAENA
KVALRARQVLIASHLPSYELRLNQVESIFLSAIDLYGHQFCPENLKKLIFSETTIFDVLP
TFFYHDKPVVCMAALEVYVRRAYVAYELQGLQHRPLTDGTCLLQFQFRLPSSHPNRVCVP
MGLSNPNLSRHSTELFMDSGFSPLSQRMGAMVAFDRFQDFTRNFDEVISCFADPPSEGPL
FRDARATCYNEEDEEEDQKNLREEPIHILNVALRFVDQGEDEELVPIFRSFAQSKNNILM
DYGLRRITFLIMQQREFPKFFTFRARDKFAEDRIYRHLEPALAFQLELSRMRHFHLQALP
CANHKMHLYLGTARVRARPESTDQRLFVRAIVRHSDLITKEASFEYLQNEGERLLLEAMD
ELEVAFNDKGYRTDCNHIFLNFVPTVVMDPAKIEESVRSMVMRYGRRLWRLRVLQAEVKI
NIRRSPSDPALPVRLFLTDESGYRLDISLYREVYDPSTGSIMFHSFGEKQGPLHGMLINT
PYVTKDLLQSKRFQAQSLGTTYVYDFLEMIRQALFKLWGSSESCPAEVLTFTELVLDSQG
KLMQMNRLPGGNEIGMVAFKMDLRTPEYPTGREVVFIVNDITYKMGSFGPEEDLLFLRAS
ELARAEGIPRIYVAANSGARIGFAEEVKHKFQVAWVDPADPYKGFRYLYLTPQDYTKISS
SNLVHCKHVEEAGESRYILTDIIGKDEGFGVENLRAAAAIAGESSLAYDEIVTISMVTCR
AIGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSSNQLGGVEIMHNNGVSHV
AVPDDFEGVYTILQWLSYMPKDNHSPLPIMPPTDPIEREIEFFPSKCPYNPRWMLAGRPH
PTTKGLWQSGFFDHGSFSEIMQPWAQTVVVGRARLGGIPVGVIAVETRTVELAVPADPAN
PESEAKVIQQAGQVWFPDSAFKTAQAIRDFDRERLPLLVFANWRGFSGGMKDMYDQVLKF
GAYIVDSLRQFKQPALVYIPPHSELRGGSWVVIDPTINPLHMELYADRDSRGGILEAEGT
VEIKFRKKDLVKTMRRVDEACASIAQRLGAPDLPKEKRRDLEMQLQAREEHLLPIYHQVA
VQFADLHDTPGRMQEKGVITDILQWKTARSFFYWRLRRLLLEEVVKADILSANHELSNSH
IQSMLRRWFLETEGTVKGYLWDNNQVVVEWLEKHLKEEDGAKSAIRDNIKYLKRDYALKH
IRNLVQANPEVTMDCIIHMTQDLSRAQRTQVVRLLATMDNPTSS
NT seq 6435 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcaggtgctgattgccaacaacggcattgcagccgtgaagtgcatgcgctcc
atccggcgctggtcctatgaaatgttccggaacgagagggccatccgctttgtggtcatg
gtagcccccgaggacctcaaggccaacgcagagtacatcaagatggctgaccaatatgtc
cctgtccccggagggagcaacaacaacaattacgccaatgtggagctcatcgtggacatc
gccaggcgcatcccagtccaggccgtttgggctggatggggccacgcttccgaaaacccc
aaactacccgaattgttgcacaaacatgggattgccttcctaggtccatccagtgaagcc
atgtggtctttaggggacaaagtggcctccaccattgtggcccagaccctccaggtgccc
accctaccatggagcggaagcggtttggtggcagaatggacttcttcggaggaagatgaa
ggtccgacaaagaccctctttgtcccaccagaaacatatagaaaggcctgcgtgaaggat
gttgaggaaggcctggaggccgccaagaggatcggcttcccggtcgtgatcaaggcctcg
gaaggaggaggcgggaaagggatccgggtggcagaagcggccgaaggtttccctgttcga
ttccgacaggtccaaagtgaggctccggggtcccccttgtttgtgatgagtttcctgcct
cattcccgccacttagaggtccaggtcctggccgaccagtatggcaacgccctctcctta
ttcacccgagatggctccctccaacggcggcaccagaagatcattgaagaggcccccgcc
tccgtggccccgccatccgccttccgctgcatggagcagtgggcagtgcgcctggccaag
agcgggggcttcgtgggggccgggacggtggagtacctctatgcagaaggaggagctcct
tacttcctggagctgaacccccgcctccaggtggagcacccttgcactgagatggtagcc
gacgtcaacctcccggcagcacaactccagatcgcgatggggatccctctgcaccggatc
aaggacatccgcactctctatggggagcccccctgggatgataccccaatatcctttgat
aaccccagcaccgtcccagtgcccaggggccatgtgattgctgcccggatcactagcgag
aatccagaggagggcttcaagcccagctctgggacggtgcaggagctgaactttcgcagc
agccgggacgtctggggatacttcagtgtggcggccgccggggggcttcacgaattcgcc
gactcccagtttggacactgcttctcctggggagaggaccgggaggaggccattgcgaac
ctggtggtggccctgaaggaactctccatccggggggacttccagaccaccgtcgagtat
ttggtcaagctgttggagacagaggccttcagggctaacgaggtcgatactagttggcta
gaccacctcattgcagggaacgtccaggtggcgcgccagtctctgagcacctatgtggtc
ctgatgaacggctccctcctggaggtggatgtccaccggctcaatgatggtgggctcctt
ctctcctttggtgggagcagccacaccacctacatgcaggaggacctgggcaggtaccgc
atcactgttggcaatcagacctgtgactttgagaaggagaatgacccaacgctactccgc
tcttcttctgccgggaagcttctgcaatacactgtggacgatgggagccatgtttgtgct
ggacatagctatgcagaaatggaggtcatgaagatggtggtgaccctctccgtggaggac
tctggggtcattcattacctgaaacgtcctgggaccctactggagcccgaatgtgtcatc
gccaagctggaactggacaaccccagcaaagttcacccagcccagctttacaccggaagc
ctccctccacagcaacccctgcccctcctcggggggaatccccaccaggtctttcggaac
gtcttggacagccttgtgaatgtcctgaatgggtactgtttgccggagccctacttcagc
gccaaggtccaggactgggtcgggacgctgatgcagaccctgcgggacccctccctgccc
ctcctggagctgcaggagctcatgaccagcctctcaggtcgcttgccgccttctgtggag
aaggccatacggacagccatggcccagtatgccagcaacgccacctccgtcctctgccag
ttccccagccagcagatcgccagtatcctggacagtcatgctgcaacattgcaacgcaag
actgaccgggaggccttcttcatggacactcagagcatcgtccaactggtccagaggtac
cgcagtgggatccggggccacatgaagtcggtggtcttggacctcttgaggcgctacttg
caggtggagtccgagttccagcaagcccattacgagaagagtgtgatgcgcctgcgggag
cgccacctgcgggacctggccccggtcctgggctgcctcttctcccactctcaagtggcc
cacaagaaccgcctggtggtcagcctcatcgagcagctctggggccgggacccgactctg
acagaggagctggaggccatcttgaacgaactgacccagctgcatcgggcggagaatgcc
aaggtggccctcagggccaggcaggtgttgattgcgtcccacctgccgtcctatgaactg
aggctcaaccaggtggagtccatcttcctctcagccattgatttgtatgggcaccagttc
tgccccgaaaacctgaagaagttgatcttttcagaaaccaccatctttgacgtcttgcct
actttcttctatcacgacaagcccgtggtctgcatggcagcattggaggtttatgtgcgg
agggcctacgtggcctatgagctgcaaggcctgcagcatcgcccattgactgacggcacc
tgccttctgcagttccagttcagactgccctcctcccaccccaacagggtgtgtgtccca
atggggctctcgaacccgaacctgtcccgccacagcactgagctcttcatggacagcggc
ttctcccctctttcccagcgaatgggtgccatggtggcctttgaccgcttccaggacttc
accaggaacttcgatgaggtcatttcctgttttgcggacccgccctcggaggggcccctc
ttccgagatgccagggccacctgttacaatgaggaagatgaagaagaggatcagaagaat
ctccgggaggagcccatccacattctgaatgttgccctccgttttgtggatcaaggcgaa
gatgaggagctggtgcccatcttccgttccttcgcacagtccaagaacaatatcctcatg
gattatgggctccggagaatcacatttttgatcatgcagcaaagggagtttcccaagttt
ttcaccttccgggcccgagacaagtttgctgaggaccgcatctaccggcacctggaacct
gccttggccttccagctggagctgagccgcatgcgccacttccacctgcaggccttgcct
tgtgccaaccacaagatgcacctctacctggggaccgccagggtcagggcccgccctgag
agcactgaccagcgcctcttcgtccgtgccatcgtccgacactcggacctcatcaccaag
gaggcctcctttgagtacctgcagaatgaaggagagcgcctattgttagaggccatggat
gagctggaggtagccttcaatgacaaaggctaccgcactgactgcaaccacatctttctc
aacttcgtccccaccgtcgtcatggatcccgccaagatcgaggagtctgtgcgctcgatg
gtgatgcgctatgggcgccgtctgtggcggctgcgtgtccttcaggccgaggtcaagatc
aacatccgccgatcaccctctgaccctgccctccctgttcgcctattcctcaccgacgaa
tccgggtaccgcctggacatcagcctgtacagggaggtctacgaccccagcactggaagc
atcatgttccattcctttggggaaaagcagggacccctgcacgggatgctcatcaacaca
ccgtacgtcaccaaggatctgctccagtccaagcgcttccaggcccagtccctgggcacc
acctatgtctacgacttcctggaaatgatccggcaggctctgttcaagttatggggttcc
tcagagtcttgtcctgcggaggtcttgacctttacggagctagtgctggactcccagggc
aaactgatgcagatgaatcgccttcctggtggaaacgagatcgggatggtggccttcaag
atggatctgaggactcccgaataccccacgggccgcgaggtggtgttcattgtcaacgac
atcacctacaagatggggtcgttcggtcctgaggaggacctgctcttcctgcgcgcctca
gagctagccagggctgagggcatccccaggatctatgtggccgccaacagtggagcccgt
attgggtttgctgaggaggtcaagcacaagttccaagtggcctgggttgaccccgcagac
ccctacaagggattcagatatctgtacctgaccccccaggactacaccaagatcagttcc
tcaaacttggtgcattgcaaacatgtggaggaggctggcgagtccaggtacatcctcact
gacataatcggcaaagatgagggctttggggtggagaacctcagggcagcggcggccatc
gcaggggagtcgtccctcgcctatgatgaaatcgtcaccattagcatggtcacctgccgc
gccattgggattggggcctatttggtgaggcttggccagcgagtcattcaggtggaaaac
tcccatatcatactgacaggagctggagctctgaataaggtcttggggagggaagtctac
acttccagcaaccaactgggaggagtggaaatcatgcacaacaatggcgtctcccacgtt
gccgtccctgacgatttcgaaggtgtctacaccatcctgcaatggctctcctatatgcca
aaggacaatcacagcccattacccatcatgccacccactgaccccattgagagagagatt
gagtttttcccttccaaatgtccctataatccccgatggatgctggctgggaggcctcac
cccacaacaaagggattgtggcaaagtggcttctttgaccatggctccttctcggaaatc
atgcagccttgggcccagacggtggtggtcggccgagccaggttgggagggatcccagtt
ggggtaattgctgtggaaacaaggacagtggagctggcagtccctgctgaccccgcgaat
cctgagtcggaagcaaaggtcatccagcaagctggacaggtctggttcccggattcggcc
ttcaagacggcccaggctattagggactttgatcgtgagcgcctcccgctcttagtattt
gctaactggaggggcttctccggagggatgaaagatatgtatgaccaggtgctgaagttt
ggggcctacattgtggacagcctgcggcagttcaagcagccggccctggtctacattccg
ccgcacagcgagctacggggcggctcctgggtagtcattgatcccaccatcaacccgctg
cacatggagctctatgccgacagggatagccggggtggcatcctggaggcggagggcaca
gtggagatcaagttccgcaagaaagacctggtcaaaaccatgcggagagtcgatgaggcc
tgtgccagcatcgctcagaggctgggtgcaccggatctccccaaagagaagcgccgagat
ttggagatgcagctgcaggcgagggaggagcaccttctcccgatctaccaccaggtggca
gtacagttcgccgacctccatgacactccagggcgcatgcaagagaagggggtcatcacg
gatatcctccagtggaaaacggcccggagcttcttctactggcgtctgcggcgtctcctg
ctggaggaagtggtcaaggcggacatcctcagcgccaaccacgagctcagcaacagccac
atccagtccatgctgcgccggtggttcctggagacggaagggacagtcaagggctacctc
tgggacaacaaccaggtggtggtggaatggctagagaaacatctgaaggaggaagacggg
gccaagtctgccatccgggacaacatcaaatacttgaagcgggactacgccctcaagcac
atccggaacttggtccaagccaaccccgaggtgaccatggactgcatcatccacatgacc
caggatctctcgagagcccagcggacccaagttgttcggcttttagccaccatggacaac
ccaacttcctcttga

DBGET integrated database retrieval system