KEGG   Anolis carolinensis (green anole): 100566853Help
Entry
100566853         CDS       T01608                                 

Gene name
plcb1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04020  Calcium signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04310  Wnt signaling pathway
acs04371  Apelin signaling pathway
acs04540  Gap junction
acs04621  NOD-like receptor signaling pathway
acs04912  GnRH signaling pathway
acs04916  Melanogenesis
acs04933  AGE-RAGE signaling pathway in diabetic complications
Module
acs_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100566853 (plcb1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100566853 (plcb1)
   04371 Apelin signaling pathway
    100566853 (plcb1)
   04020 Calcium signaling pathway
    100566853 (plcb1)
   04070 Phosphatidylinositol signaling system
    100566853 (plcb1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100566853 (plcb1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100566853 (plcb1)
  Endocrine system
   04912 GnRH signaling pathway
    100566853 (plcb1)
   04916 Melanogenesis
    100566853 (plcb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100566853 (plcb1)
   04270 Vascular smooth muscle contraction
    100566853 (plcb1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100566853 (plcb1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100566853 (plcb1)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100566853 (plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100566853 (plcb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154 C2
Motif
Other DBs
NCBI-GeneID: 100566853
NCBI-ProteinID: XP_008115330
Ensembl: ENSACAG00000002652
Position
1
AA seq 1236 aa AA seqDB search
MAGAQPGVHALQLQPVRVSASLKKGTAFLKWDDDSTSVTSVFLRTDPNGFFLYWTDQNKV
QESELLDISLVKDARCGKHARAPKDPKVREHLDAGNIGGRLEHRMLTIVYGPDLVNISYL
NLVAAQEDIAKEWSEEIFNLATNLLAQNMSRDALLEKAYTKLKLQVTTEGRIPLKNIYRL
FSSDRKRVETALEACNLPSARNDFIPQDDFTPEMYREFLSNLCPRPEIDHIFQELGAKTR
PYLTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQQLIEKYEPNNALAKKGQISVDGFMR
YLSGEENGVVPPEKLDVNEDMAQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGC
RCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPYPILLSFENHVDS
PKQQAKMAEYCRLIFGDALLMEPLEKYPLERGVPLPSPADLMGKILVKNKKKSHKSADGA
AKKKLAEQASNACSDASSGFEPSSPGAGEAEIESDDDDDDDDDCKKSMEEGTAGSEAMAT
EEMSNLVNYIQPVKFESFEISQKRNKSFEMSSFVETKALEQLTKSPVEFVEYNKMQLSRI
YPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLSMQINMGMYEYNGKSGYRLKPEFMRR
PDKHFDPFSEGIVDGIVANTLSVKIISGQLLSDKKVGTYVEVDMFGLPVDTRRKALKTKT
SQGNAVNPVWEEEAIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVSAIRPGYHYICLR
NERNQPLILPALFVYIEVKDYVPDTYAGNSNIYEDGIHVLHRKWFVLHLLWCSEILITCS
PKLCKLSPPEHIFQHVISVLRPAEQGDTPSEAHNEPKPAPAENGVNHAASLTPKPSTQVV
PSQPTPGSVKVPAKTEDLVQSVLTEVEAQTIEELKQQKAFVKLQKKHYKEMKDLVKKHHK
KTTDLIKEHTAKYNEIQNDYLRRRAVLEKTAKRDSKKKGETGSPDHSSSTVEQELATLDS
EMTQKLIELKEKQQQQLLNLRQEQYYSEKYQKQAHIKLLIQKLTDVAEECQNNQLKKLKE
MCEREKKELKKKMDKKRQEKITEAKSKDRSQVDEEKTEMIRSYIQEVVQYIKRLEDAQSK
RQERLVEKHKEIRQQIVDEKPKLQAELDQEYQDKFKRLPLEILEFVQEAMKGKISEDGDH
SSTTSSLTSDGGKLNHKPLQNEELEDNPGKVFDTPL
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcacagccaggggtccacgctctccagctgcagccggtccgcgtctccgcc
agcctcaagaagggcaccgccttcctcaagtgggacgatgactctaccagtgtgacatct
gtttttctccgaacagaccccaatggatttttcttgtattggactgaccaaaataaagtg
caggaatcagagctgttagatatcagccttgtcaaagatgctcgatgtgggaaacatgcc
cgagcccccaaggatccaaaagtacgcgaacatctggatgcagggaacataggaggacgt
ctggaacaccgaatgctcacaattgtttatgggcccgacttggtcaatatatcatacttg
aacttagtagcagctcaggaagacattgcaaaggaatggtcagaggaaatcttcaatctg
gcaaccaacctgctggcacagaacatgtcaagggatgctttgctggaaaaagcatacaca
aaacttaaattgcaagtgactacagagggacgtattcctttgaagaacatttatcgtttg
ttctcctcggaccgaaagcgtgttgagactgcattggaagcttgtaatcttccctctgcc
aggaacgatttcattcctcaagatgacttcaccccagaaatgtaccgagaattcctgagc
aacctgtgccctcggcctgagatcgaccacatcttccaagagctcggtgccaagaccagg
ccatatcttactgttgaccagatgatggaatttataaacctgaagcaacgagacccacga
ttaaatgagattctttatccaccactgaagcaggaacaagttcagcagctgattgaaaaa
tatgaacccaataacgctttggcgaagaaagggcagatatcagtggatggatttatgaga
tatttaagtggagaggaaaatggagtggttccacctgaaaaactggatgtgaatgaagat
atggcccagcctctgtctcattattttatcaattcctcacacaacacctacctcacagct
ggacagctggctggtaactcatctgtcgagatgtatcgccaagtacttttgtccggctgc
cgctgtgttgagctggattgctggaaaggccgaacagctgaagaagaaccggtcattaca
catggattcactatgacaactgaaatctccttcaaggaagtaatagaagctatcgctgaa
tgtgcatttaaaacatctccttatcccatcctcctctcatttgaaaaccacgtggattcc
cccaaacagcaggcaaaaatggcagaatattgcagattaatatttggtgatgctttgctg
atggagcccttggaaaaatacccactcgaacgtggtgttcctcttccaagcccagcagac
ctaatgggcaagattctggtgaagaataaaaagaagtcccacaagtctgcagatggagcc
gcaaagaagaaacttgctgaacaagcttcaaatgcatgcagtgatgcatccagtgggttt
gaaccttcctctcctggagcaggggaagcagagattgaaagtgatgatgatgacgatgac
gacgatgactgcaaaaaatcaatggaggaagggacagccggaagtgaagctatggctacc
gaggaaatgtccaacctggtgaattatatacagcctgtgaagtttgagtcatttgagatt
tctcaaaaacggaacaagagttttgaaatgtcttcctttgtggaaaccaaagcacttgag
cagctcacaaaatctcctgtcgagtttgtggagtataataaaatgcagctgagccggatt
tatccaaaagggacacgtgttgattcctcaaattacatgcctcagctcttctggaatgca
ggctgtcaaatggttgctctgaacttccaaactgtagatctgtctatgcaaataaatatg
gggatgtatgaatataatggcaaaagtggatatagactaaaaccagaattcatgagaaga
ccagacaagcattttgatccatttagtgaaggtattgtagacggaatagtagcaaacacg
ttgtctgtgaagatcatttctggacagcttctttctgacaaaaaagttggaacttacgta
gaagtggatatgtttggtcttcctgtggacacaaggcggaaagctcttaagactaagacc
tctcaaggaaatgcagtgaatcctgtctgggaagaagaggccattgtatttaagaaggtt
gttttgccttctctggcctgcttgagaatagcagcctatgaagaaggaggaaaattcatt
ggtcatcgaatattgccagtatcagctattcgaccaggctatcactatatttgcctaagg
aatgaaaggaatcagccgttgattttgccagccttattcgtatacatagaggttaaagac
tatgtgcctgatacatatgcaggtaactctaatatctatgaggatggaattcatgtttta
catcggaagtggtttgttttgcatttgctttggtgctctgaaattttaataacatgttct
ccaaagctttgcaaactttctcctccggaacatatcttccagcatgtcatttcagtcttg
aggccggcagaacagggagacactccttcagaagctcataatgaacctaagcctgcacca
gctgaaaatggagtaaaccacgccgcttcccttacacctaaaccatcaactcaggttgtt
cccagccaaccaacaccaggttctgtgaaagtgccagcgaaaacagaagatcttgttcag
agtgttctgactgaggttgaagcacaaactattgaagaactaaaacaacaaaaagcattt
gtaaaactccagaagaagcattacaaagaaatgaaggatcttgtgaagaaacaccacaag
aaaaccacagatcttataaaagaacatacagcaaagtacaatgaaatccaaaatgattac
ctgagacggagggcagtcttggagaaaacagcaaaaagagacagtaagaaaaaaggtgaa
actggcagcccggatcacagctcttcaacagttgaacaagagttggccactcttgattca
gaaatgactcaaaagttaatagagctgaaagaaaagcaacagcagcaactacttaatctt
cgtcaagaacagtattatagtgaaaaataccagaagcaagcacatattaaattgctcatt
caaaagttgacagatgtagcagaggaatgccagaataatcagttgaagaaacttaaagaa
atgtgtgaaagagaaaagaaagagttaaagaaaaagatggacaaaaagagacaagagaaa
atcacagaagccaaatcaaaggataggagtcaagtagatgaggagaagacagaaatgatt
cggtcatatattcaggaggtggtgcaatacattaaaaggttagaagatgctcagagcaaa
aggcaggaaaggcttgtggaaaaacacaaggagatccgtcagcaaatagtggatgaaaag
cccaagttgcaggctgaactcgatcaagaatatcaagacaaattcaaaagactcccactg
gaaattctggaatttgtacaagaagcaatgaaaggcaaaattagtgaagatggcgaccac
agctctaccacttcttccctcacatccgatggtggaaaactgaaccataaaccactacaa
aatgaggaactggaggataatccaggaaaagtgtttgatacccctctctaa

DBGET integrated database retrieval system