KEGG   Anolis carolinensis (green anole): 100566905Help
Entry
100566905         CDS       T01608                                 

Gene name
chp2
Definition
(RefSeq) calcineurin like EF-hand protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
acs  Anolis carolinensis (green anole)
Brite
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100566905 (chp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 SPARC_Ca_bdg EF-hand_8 RST EF-hand_9 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 100566905
NCBI-ProteinID: XP_003228420
Ensembl: ENSACAG00000028583
UniProt: R4G9C0
Position
Un
AA seq 189 aa AA seqDB search
MGAQNSQPFTVPEQEEIMAETGFSQANVLRLYQRFQALDKDEKGYLSKYDLENIGTLAVN
PIGDRIINAFFQDGAVTTDFRMFARVLAHFRPVEGPGESGSINSRLNKLKFAFQLYDQDK
DGKISRAEMLQVLRMMIGIQVTDEQLECITDRTIQEADKDGDDAISFEEFAKSVEKLNIE
QKMSLRILK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggagctcaaaattctcagcctttcaccgtcccagaacaggaggagatcatggcagaa
actggcttctcccaagctaatgttttacgcctttaccagcgcttccaggccttggacaag
gatgaaaagggctacctcagtaaatatgaccttgaaaatatcgggactctagctgtgaac
ccgataggggatcggattatcaatgccttcttccaagatggtgcagtgaccactgacttc
cgaatgtttgcccgtgtcctggcccacttccggcctgtggaaggacctggagaatctggg
agcatcaacagccgtcttaacaagctaaagtttgcttttcaactatacgaccaagacaag
gatgggaagatctcacgagccgaaatgttgcaggtgctgagaatgatgattgggatccag
gtgacagatgaacaactagaatgcattactgaccgaactatccaggaggccgataaagat
ggagacgatgccatctcctttgaagaatttgcaaagtctgtggaaaagctcaacattgaa
caaaaaatgagcctccggatcctgaaatga

DBGET integrated database retrieval system