KEGG   Anolis carolinensis (green anole): 100566905Help
Entry
100566905         CDS       T01608                                 

Definition
calcineurin B homologous protein 2-like
Orthology
K17611  
calcineurin B homologous protein 2
Organism
acs  Anolis carolinensis (green anole)
Brite
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100566905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 189 aa AA seqDB search
MGAQNSQPFTVPEQEEIMAETGFSQANVLRLYQRFQALDKDEKGYLSKYDLENIGTLAVN
PIGDRIINAFFQDGAVTTDFRMFARVLAHFRPVEGPGESGSINSRLNKLKFAFQLYDQDK
DGKISRAEMLQVLRMMIGIQVTDEQLECITDRTIQEADKDGDDAISFEEFAKSVEKLNIE
QKMSLRILK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggagctcaaaattctcagcctttcaccgtcccagaacaggaggagatcatggcagaa
actggcttctcccaagctaatgttttacgcctttaccagcgcttccaggccttggacaag
gatgaaaagggctacctcagtaaatatgaccttgaaaatatcgggactctagctgtgaac
ccgataggggatcggattatcaatgccttcttccaagatggtgcagtgaccactgacttc
cgaatgtttgcccgtgtcctggcccacttccggcctgtggaaggacctggagaatctggg
agcatcaacagccgtcttaacaagctaaagtttgcttttcaactatacgaccaagacaag
gatgggaagatctcacgagccgaaatgttgcaggtgctgagaatgatgattgggatccag
gtgacagatgaacaactagaatgcattactgaccgaactatccaggaggccgataaagat
ggagacgatgccatctcctttgaagaatttgcaaagtctgtggaaaagctcaacattgaa
caaaaaatgagcctccggatcctgaaatga

DBGET integrated database retrieval system