KEGG   Anolis carolinensis (green anole): 100566915Help
Entry
100566915         CDS       T01608                                 

Gene name
pomt2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100566915 (pomt2)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100566915 (pomt2)
Glycosyltransferases [BR:acs01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100566915 (pomt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 735 aa AA seqDB search
MPVAAKESCPAALGLRPRRTLRLASGRPALPSPSPRSPAGWFWSPLGLVASLSFATRFYR
LREPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYMSGYDGTFPFQKPGDK
YEHHNYIGMRGFCAFLGSCLIPFCYLTVLELSKSLHAAMLTAAFLIFDTGFITLSQYILL
DPILMFFLMGAVLSMVKYNSCANRSFSAPWWFWLALTGINLAGAMGVKFVGLFVVLFVGL
NTICDLWELLGDLSLSLVTLGKHFLARVLCLILLPLALYTALFAVHFAVLNRSGPGDGFF
SSGFQSRLIGNNLHNVSVPEYLAYGSIVTVKNLRMAGGYLHSHWHLYPEGVGARQQQVTA
YLHKDLNNLWIIKKHNVNTDHSDPSFPVEFVRHGDVIRLEHKETSRNLHSHQHEAPLTRK
HLQVTGYGINGSGDSNDFWRIEVAGRKAGKRIKVLRSQIRLIHLATGCILGSTGKTLPKW
GWEQVEVTCTPYQKESPNTLWNVEDHINPRLPNISLDVLKPSFPEILLESHMVMIRGNSG
LKPKENEVTSKPWHWPINYQGLRFSGINETDYRVYLLGNPVIWWMNLITIGLYLIMAMFV
SVALKRGVQLTAEHKELSQVLLNGGGIIMLGWLLHYLPFFMMGRVLYFHHYFPAMLFSTM
LTGITWDVFLKFWAGSQASGIQRRKIYQYGIVMLILLSMYSFYLFHPLSYGMVGPLASDP
NSPMAGLRWLETWEF
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggcggcgaaggagagctgcccggccgcgctgggcctgaggccacgaaggacg
ctcaggctggcgagcggccgccccgcgttgccctctccctcccctcggagccccgccggc
tggttctggagcccgctcggcctcgtcgcatccctcagcttcgccacccgcttttaccgt
ctgagggagccgccgcacatctgttgggatgaaacacattttggaaagatgggaagctac
tacattaacaggacctttttctttgatgtccacccacctcttgggaagatgttgatagga
cttgctggctatatgagtggctatgatggaacatttcctttccaaaaaccaggggacaaa
tatgaacatcacaactacataggaatgagagggttctgtgcattccttggttcatgcctg
attcccttctgctacctcacagttctggagctgtctaaatcattgcatgcagcaatgctc
acagctgccttcctgatctttgacacagggttcatcactctctctcaatacattctactt
gaccccattctgatgttcttcctcatgggagctgtactcagtatggtcaagtataattcc
tgtgcaaacaggtcattttctgccccctggtggttctggcttgcattgactggaataaac
cttgcaggtgcaatgggagtgaaatttgttggcctttttgtagttctcttcgttggactg
aacactatctgtgacctttgggagttgctgggagatctcagtttgtcattggtcactctg
gggaagcactttctggcgcgtgtactctgcctcattctgctgccacttgccctctacaca
gctctgtttgctgttcattttgcagtcttaaatagaagtggacctggcgatggctttttc
agctctggatttcagtctcggttgattgggaacaatcttcataatgtctctgttccggaa
tacttggcatatggctctatagttacagtaaagaaccttcgtatggcaggtggatatctt
cactcacattggcatttgtatcctgagggagttggagcacggcagcaacaggtcactgca
tatttacacaaggacttgaataacttatggattataaagaaacacaatgtaaatacagat
cattcagacccatccttccctgtggagtttgtgaggcatggagatgtaattcgcctggaa
cataaagagacttctagaaacctacacagtcatcaacatgaagctcccttgacaagaaaa
catcttcaggtcactggatatggcataaatggatcaggagattccaatgatttctggcga
attgaggttgcaggaagaaaagctgggaaacgtatcaaagtcctgcgtagtcaaatccga
ctgattcacttggctactggttgcatcttgggttcaactggaaagacactgcccaaatgg
ggctgggagcaggtggaggtcacttgtactccatatcagaaagagagtcctaatactctc
tggaatgttgaagatcacatcaatcccaggttgccgaatatcagtctggatgttctgaaa
ccgtcttttccagagattcttctggagtctcacatggttatgatccgaggaaacagtggc
ctcaagccaaaggagaacgaagtcacatccaagccctggcattggcccatcaattatcaa
ggccttcgtttttctggaatcaatgaaaccgactatagagtttatttgctaggaaacccg
gtgatctggtggatgaacttaatcacaattggattatatctcataatggcaatgtttgta
tctgtggccttgaagagaggagtccagttgacagctgagcacaaagagctttctcaagtc
ctgctgaatggcggaggaataattatgttaggatggcttcttcattatcttcctttcttc
atgatgggacgagtgctctattttcaccattattttcctgccatgcttttctccaccatg
ttgacaggcattacatgggatgtgttcctgaaattctgggctgggtcccaggcatctggc
atccaaaggagaaaaatttaccagtatggaatagtgatgttgatccttctcagtatgtac
agcttctacctcttccatcctctctcctatgggatggtaggacctctggcttctgatccc
aacagcccaatggcagggcttaggtggctggaaacatgggaattctag

DBGET integrated database retrieval system