KEGG   Anolis carolinensis (green anole): 100566976Help
Entry
100566976         CDS       T01608                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100566976
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100566976
   04370 VEGF signaling pathway
    100566976
   04020 Calcium signaling pathway
    100566976
   04070 Phosphatidylinositol signaling system
    100566976
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100566976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1299 aa AA seqDB search
MSLSRLNSFVNGFLEDPSGPEAGGPDMTRILSALEVGTVLTLFYQKKSQRPERRTFQVRL
KSRQIVWSRTLEKVEGDVDIREIKEIRSGKNSRDFERYPEDARKLDSALCFVILYGMDFR
LKTLSVAAFCEDDVNLWVAGLNWLVTDTQRAPSPLHIERWLRKQFDSMDRSREGSITPKD
LKAMLPQANYRVPNMRFLRDKLMEVEVRNEITFSHFAHFYKNLMFDAQKSIIEQLELSFP
LRNVDRPELCQITLYDFQKFLQHDQKEPWASDIAKVREQMCSYLRDPFSDMAEPFFQLDE
FLTYLFSKENMVMDSKYEQVAPEEMNYPLSYYWISSSHNTYLTGDQFSSESSLEAYARCL
RMGCRCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEHAFTTSEFPIILSIEDHC
SIVQQRNMASHFKKVFGDMLLTKPVDINADQLPSPAQLRKKILIKHKKLVEGNLYEEVTT
ATYSENDISNSIKNGILYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQSNEDEEETEQK
EEFNNNELHFSEKWFHGKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESETFVGDYT
LSFWRSGRVQHCRIHSRQEAGATKFYLTDNLVFDSLYSLICHYREVPLRCNEFEMRLTDP
VPQPNAHESKEWYHANLTRLQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCR
IQQEGRLFMLGSSAEFESLVDLVSYYEKHPLYRKMKLRYPINEETLEKMGTAELDYGALY
EVRTPHFYVEANKMPMAKCTVKALYDYKAQREDELSFCKQAIIHNVDKQDGGWWRGDYGG
KKQLWFPANYVEEIMNASGAEQDEASVENSPLGNFLKGFIDVPSCHVVISKDGRSSKPFV
FTIHSQQMTHPSQSLDVATDTQEELNDWVAKIREATQNADARMQEGKIMERRKKIALELS
ELVVYCRPVPFDEEKIGTEKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQLSRIYPK
GQRLDSSNYDPLSMWICGSQLVALNFQTPDKPMQLNQSLFMLGGRSGYVLQPDIMRDDLF
DPFDKSSLKHVEPITVQLQILGARHLPKNGRSIVCPFVEVEVCGSEFDNSKNKTEVVADN
GLNPVWLVKQFVFDINNPEFAFLRFVVYEEDMFSDPNFLAQATFPIKGLKTGYRSVPLKN
SYSEDLELASLLLHIEIVNAKEEDDENLYSSIQQLRDRANELSNQVSNFEQSNNCDSRYQ
QRLDELRAAQERLMELTEVRNRKLMEKKKRDRQLANKRN
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctccaggctgaacagctttgtcaatggcttcttggaggacccttcggggccc
gaggccggggggccggacatgacccgcatcctcagcgccttggaggtgggcaccgtcctc
accttgttctaccagaagaagtcccagcggccagaacggaggaccttccaagtccggcta
aagagccggcagatcgtctggagtcgcacgctggagaaggtggaaggagatgtggatatt
agggaaattaaggagatccggtcagggaagaattcccgggactttgagcgctaccctgaa
gatgcccggaagctggactccgccttgtgttttgtcatcttatacggaatggacttccgg
ctgaagacgttgagcgtggctgcgttttgcgaagatgacgtcaatctctgggtggcaggc
ctgaattggttggtgactgacacgcagcgagcaccgtctcctctccatatcgaaaggtgg
ttgaggaaacagtttgattcgatggacagatcaagggaaggcagcatcaccccaaaggat
ctgaaggcgatgctgccccaagccaactaccgggtccccaatatgagattcctgagagac
aaacttatggaggtggaagtccgtaatgaaatcaccttcagccactttgcacacttctat
aagaacctgatgtttgacgcccagaaatcgatcattgaacagctggaattgtctttccct
ttacgaaatgtggaccggccagaactctgccagatcacattgtatgacttccagaagttc
ctacaacacgatcagaaggagccatgggcaagtgacattgctaaagtccgagagcagatg
tgcagctacctgcgggatcccttcagcgacatggcagagcctttcttccagttggatgag
ttcctgacgtacctgttctccaaagaaaacatggtcatggactccaagtacgagcaggtg
gcgcccgaggaaatgaattaccccttgtcttactactggatctcctcttctcataacacg
tacctgactggggaccagttctccagcgaatcctccctcgaagcctacgctcgctgcctc
cggatgggatgccgctgcattgagctggattgctgggacggacccgacgacctgcccatc
atctaccacggccacacgctcacctccaagatcaagttcttggacgtgctgcacaccatc
aaggagcatgccttcaccacctctgagttccccatcatcctctccatcgaggaccactgc
agcatcgtccagcagaggaacatggcctcgcacttcaagaaggtctttggggacatgctg
ttgaccaagccagtggacatcaacgctgaccagctgccctcccctgcccagctcaggaag
aagatcctcattaagcacaagaagctggtcgaagggaacctgtatgaggaagtcaccacg
gccacgtactcggagaacgacatcagcaactccatcaagaacggcatcctttacctggag
gaccccatcgaccatacctggagcccacactattttgtcctgaccagcaacaagatctat
tattccgaggagacctctcgctaccaatccaatgaggatgaggaagagacagaacagaaa
gaggaatttaacaacaacgagctgcacttcagcgagaaatggttccacggcaagctgggc
gggggccgcgacgggcggcagattgcggagaagctgctgcacgagtattgcacggagacc
gggggcaaggacggcaccttcctggtgcgggagagtgagacctttgtgggcgactacacc
ctctccttctggcgctccggccgcgttcagcactgccgcatccattcccggcaggaagcc
ggagccactaaattctacctgacggacaacctggtcttcgacagcctctacagcctcatc
tgccactaccgggaggtgcctctgcgctgcaacgagttcgagatgcggctgacggacccg
gtgccgcaacccaacgctcacgagagcaaagagtggtaccacgccaacctgacccgcttg
caggctgaacacatgctgatgcgcgttccccgggacggggccttcctggtgcggaagcgc
agcgagcccaactcatacgccatctctttccgagcggaaggcaagatcaagcattgccgc
atccagcaggagggtcgtctgttcatgctgggcagttcggccgagtttgagagcctggtg
gacctggtcagctactacgagaagcaccccttgtaccgcaagatgaagctgcgctacccc
atcaacgaggagactctcgagaagatgggcaccgctgaattggactacggcgctttgtac
gaggtgcgcacccctcacttttacgtggaagccaacaagatgccaatggccaagtgcacc
gtgaaggccttgtatgactacaaagctcagcgggaagacgagctgtccttctgcaaacaa
gccattattcacaacgttgacaagcaggacggagggtggtggcgcggagactacgggggc
aagaagcagctctggttccccgccaactacgtcgaggagatcatgaatgcctctggggcc
gagcaggatgaagcgtctgtagagaacagtccgctgggcaactttctaaagggcttcatt
gatgtcccttcctgccatgtagttatctccaaagacgggaggagctccaaaccatttgtc
ttcaccatccattcccagcagatgacccacccgtcccagtcgctggacgtcgccaccgac
acccaggaggagctcaacgactgggtggccaagatccgagaggccactcagaacgcagac
gcccggatgcaagaaggaaagatcatggaacggaggaagaaaattgccctggagttgtca
gaactggtcgtttactgtcgcccggtaccctttgatgaggagaagatcggcacagagaaa
gcctgctaccgggacatgtcctcttttcccgagaccaaggcggagaagtacgccaaccgc
agcaaagggaagaagttcctgcagtacaaccgccggcagctgagccgcatctaccccaag
ggccagcgcctggactcctccaactacgacccgctctccatgtggatctgcggcagccag
ttggtggccctcaacttccagacccccgataagccgatgcagttgaaccagtcgcttttc
atgctggggggccgcagcggctacgtgttgcagccggacatcatgcgtgacgacctcttt
gacccctttgacaagagcagcttgaagcacgtggagcccatcacggtccagctgcagatc
ctgggggcccggcacctccccaagaacggccgcagcatcgtttgcccctttgtggaagtg
gaggtctgcggctctgagttcgacaacagcaagaacaagacggaggtcgtagctgacaac
ggtctcaatccagtctggctcgtcaagcagtttgtcttcgacatcaacaacccggagttt
gccttcctccgcttcgtcgtctacgaggaggacatgttcagtgaccccaacttcttggct
caggcaacgttccccatcaagggccttaaaacaggttacagatccgttcccctgaagaac
agctatagtgaggatcttgagctcgcttctctgcttctccacattgaaattgtcaatgcc
aaggaagaagacgacgagaacttgtactcctccatccagcaactccgggaccgcgccaat
gagctctccaaccaggtctccaactttgaacaaagcaacaattgtgactcacgctaccag
cagcggctggatgaactcagggcggcacaagagcgactcatggaactgacggaagtgcgc
aacaggaagttgatggagaagaagaagcgagaccggcagttggccaacaagcgcaactga

DBGET integrated database retrieval system