KEGG   Anolis carolinensis (green anole): 100566976Help
Entry
100566976         CDS       T01608                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:acs00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:acs04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:acs04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:acs04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:acs04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 890 aa AA seqDB search
FPIILSIEDHCSIVQQRNMASHFKKVFGDMLLTKPVDINADQLPSPAQLRKKILIKHKKL
VEGNLYEEVTTATYSENDISNSIKNGILYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQ
SNEDEEETEQKEEFNNNELHFSEKWFHGKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLV
RESETFVGDYTLSFWRSGRVQHCRIHSRQEAGATKFYLTDNLVFDSLYSLICHYREVPLR
CNEFEMRLTDPVPQPNAHESKEWYHANLTRLQAEHMLMRVPRDGAFLVRKRSEPNSYAIS
FRAEGKIKHCRIQQEGRLFMLGSSAEFESLVDLVSYYEKHPLYRKMKLRYPINEETLEKM
GTAELDYGALYEVRTPHFYVEANKMPMAKCTVKALYDYKAQREDELSFCKQAIIHNVDKQ
DGGWWRGDYGGKKQLWFPANYVEEIMNASGAEQDEASVENSPLGNFLKGFIDVPSCHVVI
SKDGRSSKPFVFTIHSQQMTHPSQSLDVATDTQEELNDWVAKIREATQNADARMQEGKIM
ERRKKIALELSELVVYCRPVPFDEEKIGTEKACYRDMSSFPETKAEKYANRSKGKKFLQY
NRRQLSRIYPKGQRLDSSNYDPLSMWICGSQLVALNFQTPDKPMQLNQSLFMLGGRSGYV
LQPDIMRDDLFDPFDKSSLKHVEPITVQLQILGARHLPKNGRSIVCPFVEVEVCGSEFDN
SKNKTEVVADNGLNPVWLVKQFVFDINNPEFAFLRFVVYEEDMFSDPNFLAQATFPIKGL
KTGYRSVPLKNSYSEDLELASLLLHIEIVNAKEEDDENLYSSIQQLRDRANELSNQVSNF
EQSNNCDSRYQQRLDELRAAQERLMELTEVRNRKLMEKKKRDRQLANKRN
NT seq 2674 nt NT seq  +upstreamnt  +downstreamnt
gttccccatcatcctctccatcgaggaccactgcagcatcgtccagcagaggaacatggc
ctcgcacttcaagaaggtctttggggacatgctgttgaccaagccagtggacatcaacgc
tgaccagctgccctcccctgcccagctcaggaagaagatcctcattaagcacaagaagct
ggtcgaagggaacctgtatgaggaagtcaccacggccacgtactcggagaacgacatcag
caactccatcaagaacggcatcctttacctggaggaccccatcgaccatacctggagccc
acactattttgtcctgaccagcaacaagatctattattccgaggagacctctcgctacca
atccaatgaggatgaggaagagacagaacagaaagaggaatttaacaacaacgagctgca
cttcagcgagaaatggttccacggcaagctgggcgggggccgcgacgggcggcagattgc
ggagaagctgctgcacgagtattgcacggagaccgggggcaaggacggcaccttcctggt
gcgggagagtgagacctttgtgggcgactacaccctctccttctggcgctccggccgcgt
tcagcactgccgcatccattcccggcaggaagccggagccactaaattctacctgacgga
caacctggtcttcgacagcctctacagcctcatctgccactaccgggaggtgcctctgcg
ctgcaacgagttcgagatgcggctgacggacccggtgccgcaacccaacgctcacgagag
caaagagtggtaccacgccaacctgacccgcttgcaggctgaacacatgctgatgcgcgt
tccccgggacggggccttcctggtgcggaagcgcagcgagcccaactcatacgccatctc
tttccgagcggaaggcaagatcaagcattgccgcatccagcaggagggtcgtctgttcat
gctgggcagttcggccgagtttgagagcctggtggacctggtcagctactacgagaagca
ccccttgtaccgcaagatgaagctgcgctaccccatcaacgaggagactctcgagaagat
gggcaccgctgaattggactacggcgctttgtacgaggtgcgcacccctcacttttacgt
ggaagccaacaagatgccaatggccaagtgcaccgtgaaggccttgtatgactacaaagc
tcagcgggaagacgagctgtccttctgcaaacaagccattattcacaacgttgacaagca
ggacggagggtggtggcgcggagactacgggggcaagaagcagctctggttccccgccaa
ctacgtcgaggagatcatgaatgcctctggggccgagcaggatgaagcgtctgtagagaa
cagtccgctgggcaactttctaaagggcttcattgatgtcccttcctgccatgtagttat
ctccaaagacgggaggagctccaaaccatttgtcttcaccatccattcccagcagatgac
ccacccgtcccagtcgctggacgtcgccaccgacacccaggaggagctcaacgactgggt
ggccaagatccgagaggccactcagaacgcagacgcccggatgcaagaaggaaagatcat
ggaacggaggaagaaaattgccctggagttgtcagaactggtcgtttactgtcgcccggt
accctttgatgaggagaagatcggcacagagaaagcctgctaccgggacatgtcctcttt
tcccgagaccaaggcggagaagtacgccaaccgcagcaaagggaagaagttcctgcagta
caaccgccggcagctgagccgcatctaccccaagggccagcgcctggactcctccaacta
cgacccgctctccatgtggatctgcggcagccagttggtggccctcaacttccagacccc
cgataagccgatgcagttgaaccagtcgcttttcatgctggggggccgcagcggctacgt
gttgcagccggacatcatgcgtgacgacctctttgacccctttgacaagagcagcttgaa
gcacgtggagcccatcacggtccagctgcagatcctgggggcccggcacctccccaagaa
cggccgcagcatcgtttgcccctttgtggaagtggaggtctgcggctctgagttcgacaa
cagcaagaacaagacggaggtcgtagctgacaacggtctcaatccagtctggctcgtcaa
gcagtttgtcttcgacatcaacaacccggagtttgccttcctccgcttcgtcgtctacga
ggaggacatgttcagtgaccccaacttcttggctcaggcaacgttccccatcaagggcct
taaaacaggttacagatccgttcccctgaagaacagctatagtgaggatcttgagctcgc
ttctctgcttctccacattgaaattgtcaatgccaaggaagaagacgacgagaacttgta
ctcctccatccagcaactccgggaccgcgccaatgagctctccaaccaggtctccaactt
tgaacaaagcaacaattgtgactcacgctaccagcagcggctggatgaactcagggcggc
acaagagcgactcatggaactgacggaagtgcgcaacaggaagttgatggagaagaagaa
gcgagaccggcagttggccaacaagcgcaactga

DBGET integrated database retrieval system