KEGG   Anolis carolinensis (green anole): 100567011Help
Entry
100567011         CDS       T01608                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100567011
  Cell communication
   04510 Focal adhesion
    100567011
   04530 Tight junction
    100567011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTQRKAAAKQAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKSDLKETY
GQLGKMNVKDEELDEMLKEGKGPINFTVFLTLFGEKLNGTDPEESILAAFKLFDPNASGY
VNKDEFKQLLMTQADKFTPEEVEQMFALAPIDVAGNIDYKSLCYIITHGDEKED
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaagctgggactcaaaggaaagctgcagcaaaacaggcccagagggga
tcctctaatgttttctccatgttcgagcagtcacagatccaggagttcaaggaggcattc
agctgcattgaccaaaatcgtgatggaattatcagcaaatcagacttaaaagagacctat
gggcaacttgggaaaatgaatgtgaaagatgaggagctggatgagatgctaaaggaaggg
aaagggccgataaacttcacagtcttcttaacactctttggggagaaactgaacggtact
gacccagaagaatcgatccttgctgccttcaagctttttgacccaaatgcaagtggctat
gtgaacaaagatgaatttaaacagctcctgatgacacaggcagacaaattcactcctgag
gaggtagaacaaatgtttgcattagctcccattgacgtagctggaaacattgactacaaa
tccttatgctacatcatcacacatggtgacgagaaggaagactga

DBGET integrated database retrieval system