KEGG   Anolis carolinensis (green anole): 100567011Help
Entry
100567011         CDS       T01608                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
Cellular Processes; Cell communication; Tight junction [PATH:acs04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTQRKAAAKQAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKSDLKETY
GQLGKMNVKDEELDEMLKEGKGPINFTVFLTLFGEKLNGTDPEESILAAFKLFDPNASGY
VNKDEFKQLLMTQADKFTPEEVEQMFALAPIDVAGNIDYKSLCYIITHGDEKED
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaagctgggactcaaaggaaagctgcagcaaaacaggcccagagggga
tcctctaatgttttctccatgttcgagcagtcacagatccaggagttcaaggaggcattc
agctgcattgaccaaaatcgtgatggaattatcagcaaatcagacttaaaagagacctat
gggcaacttgggaaaatgaatgtgaaagatgaggagctggatgagatgctaaaggaaggg
aaagggccgataaacttcacagtcttcttaacactctttggggagaaactgaacggtact
gacccagaagaatcgatccttgctgccttcaagctttttgacccaaatgcaagtggctat
gtgaacaaagatgaatttaaacagctcctgatgacacaggcagacaaattcactcctgag
gaggtagaacaaatgtttgcattagctcccattgacgtagctggaaacattgactacaaa
tccttatgctacatcatcacacatggtgacgagaaggaagactga

DBGET integrated database retrieval system