KEGG   Anolis carolinensis (green anole): 100567011Help
Entry
100567011         CDS       T01608                                 

Gene name
myl7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100567011 (myl7)
  Cellular commiunity
   04510 Focal adhesion
    100567011 (myl7)
   04530 Tight junction
    100567011 (myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTQRKAAAKQAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKSDLKETY
GQLGKMNVKDEELDEMLKEGKGPINFTVFLTLFGEKLNGTDPEESILAAFKLFDPNASGY
VNKDEFKQLLMTQADKFTPEEVEQMFALAPIDVAGNIDYKSLCYIITHGDEKED
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaagctgggactcaaaggaaagctgcagcaaaacaggcccagagggga
tcctctaatgttttctccatgttcgagcagtcacagatccaggagttcaaggaggcattc
agctgcattgaccaaaatcgtgatggaattatcagcaaatcagacttaaaagagacctat
gggcaacttgggaaaatgaatgtgaaagatgaggagctggatgagatgctaaaggaaggg
aaagggccgataaacttcacagtcttcttaacactctttggggagaaactgaacggtact
gacccagaagaatcgatccttgctgccttcaagctttttgacccaaatgcaagtggctat
gtgaacaaagatgaatttaaacagctcctgatgacacaggcagacaaattcactcctgag
gaggtagaacaaatgtttgcattagctcccattgacgtagctggaaacattgactacaaa
tccttatgctacatcatcacacatggtgacgagaaggaagactga

DBGET integrated database retrieval system