KEGG   Anolis carolinensis (green anole): 100567011Help
Entry
100567011         CDS       T01608                                 

Gene name
myl7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100567011 (myl7)
  Cellular commiunity
   04510 Focal adhesion
    100567011 (myl7)
   04530 Tight junction
    100567011 (myl7)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100567011 (myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTQRKAAAKQAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKSDLKETY
GQLGKMNVKDEELDEMLKEGKGPINFTVFLTLFGEKLNGTDPEESILAAFKLFDPNASGY
VNKDEFKQLLMTQADKFTPEEVEQMFALAPIDVAGNIDYKSLCYIITHGDEKED
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaagctgggactcaaaggaaagctgcagcaaaacaggcccagagggga
tcctctaatgttttctccatgttcgagcagtcacagatccaggagttcaaggaggcattc
agctgcattgaccaaaatcgtgatggaattatcagcaaatcagacttaaaagagacctat
gggcaacttgggaaaatgaatgtgaaagatgaggagctggatgagatgctaaaggaaggg
aaagggccgataaacttcacagtcttcttaacactctttggggagaaactgaacggtact
gacccagaagaatcgatccttgctgccttcaagctttttgacccaaatgcaagtggctat
gtgaacaaagatgaatttaaacagctcctgatgacacaggcagacaaattcactcctgag
gaggtagaacaaatgtttgcattagctcccattgacgtagctggaaacattgactacaaa
tccttatgctacatcatcacacatggtgacgagaaggaagactga

DBGET integrated database retrieval system