KEGG   Anolis carolinensis (green anole): 100567016Help
Entry
100567016         CDS       T01608                                 

Gene name
usp35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100567016 (usp35)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100567016 (usp35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1042 aa AA seqDB search
MSISFHVIAKRIFPRRREQQEGGKKQAGEEGDFFCFSCSILCSQEEGKKVKMDKILEAIV
MSSYPDHMKQGLVRRVIEASKQSMDSEQCWLMLELSTKLFLVGDTKFKRSVGKEVLEAYG
LYHQEVFEEFFNVRFLLSLLQEGYGPLGKRSLYVFDYIHLGLAFVLDRPSASDIFSLLRT
EVLRKVCERPGLKQCMKISKLLIQYPQCIPTGKRQALFCQQLIRCIGQFRTTSGREEAIV
DFLDHVIKVGLLLQKIWKIQVSSILPSLKELFAIISSTEDQDPPSIALASVVQYVPMELM
DGILRNLTNDDSITDVQMMMAIGRMIEWVSWPLGKNIDKWIIALLKGLAAVKKFSILIEV
TLSKIERVFSKLLYPILREGALSILCYMLLSFQHSHEAFHLLLPHIPKVVAALNKENSNS
AASCLEQLAELIHCMFFRFSGFPDLYEPVVEAIKDLPIPNEDRIKHLLGQNAWTSQKNEL
ASFYPRLASKSETGKIGLINLGNTCYMNSIIQALFMASDFRRSVLSLAENNSQPLMAKLQ
WLFAFLEHSQRPTISPESFLLASWPPWFTRGAQQDCSEYLKYLLDRLHEEERTGRRIYQK
LKGSSLKSPHSVNKTLVEKMFGGKIKTKIRCLKCLKVSSREEAFTDLSLAFPPADQPVPT
PADTTSLLPIEEMGPEILHSSLEAQPRLNDSPRRSGTFAVPRVIPSKVLSVETLGPEGQE
TPFLLRPERDANGTKPDEDSTLVLKGLEEASRSVPDLINYFLSPEMLTAENQYHCENCAS
LQDAEKLAELTEGPHYLILTLLRFSFDLRAMRRRKILDNVSVPLVLKLPVLVASEELSDA
HGGHTSSYTRFASVVYDLCSVVVHSGVSSESGHYYCYARECEDGNTKSDPKEGSWNEASE
KPPDLAIQWFLFNDTRVSFSSFESVSHVTSFLPKDTAYLLFYRQRSTQSLNGRSEAAVES
GHVNGDLHSPDKNLMEAIAKDNILFLQEQEKEARSRSAYISALPKSPLWWKDFDGDDDDN
SSGGGGHDPGGGNSGSFHGLVF
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttcattccatgttattgcaaaaaggatctttccgaggcggagagagcagcag
gagggaggaaagaagcaagcaggggaagaaggggattttttctgcttctcttgcagtata
ttgtgctcccaggaggaaggaaaaaaggttaagatggacaagatccttgaagccatcgtg
atgtcgtcttaccccgaccacatgaaacaagggttagtgcggcgtgtcattgaagcttcg
aaacagtccatggacagcgaacagtgctggttgatgctcgagctttctaccaaactcttc
ctcgtgggcgataccaagttcaagaggtcggttggcaaagaggtcctggaagcctatggc
ctttaccaccaggaggtctttgaagagttcttcaacgtccgtttcctgctcagcctcctc
caagagggctatggaccccttggcaaaagaagcctgtatgtctttgattacatccacctc
gggttggccttcgttttggatcgcccatcggctagtgatattttcagccttctgaggacc
gaagttctccgaaaggtctgcgagaggccgggactcaagcagtgcatgaaaatcagcaaa
ctcttgatccagtatcctcagtgtattcctacggggaaacggcaggctctgttctgccag
cagctcatccggtgcatcggccaattccgaaccacgtcggggagagaggaggccatcgtg
gacttcctggaccacgtcatcaaggttggcctcttgctgcagaaaatatggaagattcag
gtgtcctctattctcccgtccttgaaagaactctttgcaatcatttcatcaaccgaagat
caggacccaccgtctattgccttggccagcgtggtccagtatgtcccaatggaactaatg
gatgggatcctaagaaacctcaccaacgatgacagcataacagatgttcagatgatgatg
gcaattggcaggatgattgagtgggtctcctggcctctggggaagaacatagacaaatgg
atcattgctttgctcaagggcttggctgcggtgaagaagttcagcatcttaatcgaagtc
acgctttccaaaattgagagggtgttttccaagttgctgtatcccatcctgagggaggga
gcgctctctattctgtgctatatgctgctcagcttccagcattcgcacgaagcatttcac
ttgcttcttcctcatattcccaaagtggtggctgccctcaacaaagaaaattccaattcg
gccgcaagttgcttggaacagttggctgagctcatccactgcatgttcttccgtttctcg
ggattcccagacctctacgaacctgtcgtggaggccatcaaagatcttcccattccaaac
gaagaccgaataaaacacttgcttggccaaaacgcctggacctcacagaagaacgaattg
gccagtttttacccccgcctggcctccaaatcggaaacagggaaaatagggttaattaac
ctggggaatacctgctatatgaacagcatcatccaagctctcttcatggcctcagatttc
aggcgctctgtgctgagtttagcagagaacaattcccagcccttgatggcaaagcttcag
tggctgtttgcctttctagagcacagtcagaggcctaccatttcacctgaaagcttttta
ttggcttcatggcctccttggttcacaaggggagcccagcaggattgttctgaatacttg
aaatacctgcttgataggctgcatgaagaagagagaacagggagaagaatttatcagaaa
ctcaaaggctcctccttgaagtctcctcattctgtgaacaagactctagttgaaaagatg
ttcggtggcaaaattaagacgaaaatccgttgtctgaagtgcctaaaggtctcttccaga
gaagaagccttcacggacctctccttggctttcccaccagcggatcagcctgtgcctaca
cctgcggacactacctcgcttttacccattgaggaaatgggaccagagatcttgcattcc
agcctagaagcccagcctaggctgaatgattcgccaaggagatcaggaacgtttgctgtg
cccagggttattccttccaaagtgttgtcagtcgaaacgttaggaccggaaggtcaagaa
acccctttccttttgagacctgaacgagatgccaatgggacaaagcccgatgaagattca
acattggtcttgaagggtcttgaagaagcttcccgatctgtccccgatttgatcaattat
ttcttatcgccggagatgctgacggcggagaaccagtatcactgtgaaaactgtgcctcc
cttcaagacgcagagaagctggcggagctgacggaaggtccgcactacctcatcctcacc
ttgttgaggttctcctttgacttgagggctatgaggaggaggaagatccttgacaacgtc
tcggtccccttggtgttgaagctgccggtcttggttgcctctgaagaactgagtgatgct
catggcggccacacttcgtcatacactcgcttcgcttcggtggtgtacgatctgtgcagc
gtggtggtgcactccggagtctcctcggagagcggccattactattgctacgccagggag
tgcgaggacggcaacaccaaaagtgaccccaaggaaggttcttggaacgaagcctctgag
aaacctccagaccttgcgatccagtggttccttttcaatgacaccagggtctccttctca
tcttttgagtcggtcagccatgtcacctctttcctacccaaggacactgcatatctgctg
ttttataggcagaggtcaacccagtccctaaatggaagatctgaggcagctgtagagtct
ggccatgtgaatggagatttgcattctccagataaaaacctgatggaagccattgcgaag
gataacatcctcttcttacaggagcaggaaaaggaagcccgaagcagaagtgcctacatt
tcggctttacccaaatcccctctttggtggaaagactttgatggggatgacgatgataat
tcctcggggggtggcgggcacgatcctggcggaggaaactcaggttctttccatggactt
gtcttctag

DBGET integrated database retrieval system