KEGG   Anolis carolinensis (green anole): 100567016Help
Entry
100567016         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 35-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 785 aa AA seqDB search
MKSYLRVLILFCFCLCLNGLAEDQDPPSIALASVVQYVPMELMDGILRNLTNDDSITDVQ
MMMAIGRMIEWVSWPLGKNIDKWIIALLKGLAAVKKFSILIEVTLSKIERVFSKLLYPIL
REGALSILCYMLLSFQHSHEAFHLLLPHIPKVVAALNKENSNSAASCLEQLAELIHCMFF
RFSGFPDLYEPVVEAIKDLPIPNEDRIKHLLGQNAWTSQKNELASFYPRLASKSETGKIG
LINLGNTCYMNSIIQALFMASDFRRSVLSLAENNSQPLMAKLQWLFAFLEHSQRPTISPE
SFLLASWPPWFTRGAQQDCSEYLKYLLDRLHEEERTGRRIYQKLKGSSLKSPHSVNKTLV
EKMFGGKIKTKIRCLKCLKVSSREEAFTDLSLAFPPADQPVPTPADTTSLLPIEEMGPEI
LHSSLEAQPRLNDSPRRSGTFAVPRVIPSKVLSVETLGPEGQETPFLLRPERDANGTKPD
EDSTLVLKGLEEASRSVPDLINYFLSPEMLTAENQYHCENCASLQDAEKLAELTEGPHYL
ILTLLRFSFDLRAMRRRKILDNVSVPLVLKLPVLVASEELSDAHGGHTSSYTRFASVVYD
LCSVVVHSGVSSESGHYYCYARECEDGNTKSDPKEGSWNEASEKPPDLAIQWFLFNDTRV
SFSSFESVSHVTSFLPKDTAYLLFYRQRSTQSLNGRSEAAVESGHVNGDLHSPDKNLMEA
IAKDNILFLQEQEKEARSRSAYISALPKSPLWWKDFDGDDDDNSSGGGGHDPGGGNSGSF
HGLVF
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttacctgcgggttctgatactgttttgcttttgtttgtgtctaaatggtctt
gcagaagatcaggacccaccgtctattgccttggccagcgtggtccagtatgtcccaatg
gaactaatggatgggatcctaagaaacctcaccaacgatgacagcataacagatgttcag
atgatgatggcaattggcaggatgattgagtgggtctcctggcctctggggaagaacata
gacaaatggatcattgctttgctcaagggcttggctgcggtgaagaagttcagcatctta
atcgaagtcacgctttccaaaattgagagggtgttttccaagttgctgtatcccatcctg
agggagggagcgctctctattctgtgctatatgctgctcagcttccagcattcgcacgaa
gcatttcacttgcttcttcctcatattcccaaagtggtggctgccctcaacaaagaaaat
tccaattcggccgcaagttgcttggaacagttggctgagctcatccactgcatgttcttc
cgtttctcgggattcccagacctctacgaacctgtcgtggaggccatcaaagatcttccc
attccaaacgaagaccgaataaaacacttgcttggccaaaacgcctggacctcacagaag
aacgaattggccagtttttacccccgcctggcctccaaatcggaaacagggaaaataggg
ttaattaacctggggaatacctgctatatgaacagcatcatccaagctctcttcatggcc
tcagatttcaggcgctctgtgctgagtttagcagagaacaattcccagcccttgatggca
aagcttcagtggctgtttgcctttctagagcacagtcagaggcctaccatttcacctgaa
agctttttattggcttcatggcctccttggttcacaaggggagcccagcaggattgttct
gaatacttgaaatacctgcttgataggctgcatgaagaagagagaacagggagaagaatt
tatcagaaactcaaaggctcctccttgaagtctcctcattctgtgaacaagactctagtt
gaaaagatgttcggtggcaaaattaagacgaaaatccgttgtctgaagtgcctaaaggtc
tcttccagagaagaagccttcacggacctctccttggctttcccaccagcggatcagcct
gtgcctacacctgcggacactacctcgcttttacccattgaggaaatgggaccagagatc
ttgcattccagcctagaagcccagcctaggctgaatgattcgccaaggagatcaggaacg
tttgctgtgcccagggttattccttccaaagtgttgtcagtcgaaacgttaggaccggaa
ggtcaagaaacccctttccttttgagacctgaacgagatgccaatgggacaaagcccgat
gaagattcaacattggtcttgaagggtcttgaagaagcttcccgatctgtccccgatttg
atcaattatttcttatcgccggagatgctgacggcggagaaccagtatcactgtgaaaac
tgtgcctcccttcaagacgcagagaagctggcggagctgacggaaggtccgcactacctc
atcctcaccttgttgaggttctcctttgacttgagggctatgaggaggaggaagatcctt
gacaacgtctcggtccccttggtgttgaagctgccggtcttggttgcctctgaagaactg
agtgatgctcatggcggccacacttcgtcatacactcgcttcgcttcggtggtgtacgat
ctgtgcagcgtggtggtgcactccggagtctcctcggagagcggccattactattgctac
gccagggagtgcgaggacggcaacaccaaaagtgaccccaaggaaggttcttggaacgaa
gcctctgagaaacctccagaccttgcgatccagtggttccttttcaatgacaccagggtc
tccttctcatcttttgagtcggtcagccatgtcacctctttcctacccaaggacactgca
tatctgctgttttataggcagaggtcaacccagtccctaaatggaagatctgaggcagct
gtagagtctggccatgtgaatggagatttgcattctccagataaaaacctgatggaagcc
attgcgaaggataacatcctcttcttacaggagcaggaaaaggaagcccgaagcagaagt
gcctacatttcggctttacccaaatcccctctttggtggaaagactttgatggggatgac
gatgataattcctcggggggtggcgggcacgatcctggcggaggaaactcaggttctttc
catggacttgtcttctag

DBGET integrated database retrieval system