KEGG   Anolis carolinensis (green anole): 100567046Help
Entry
100567046         CDS       T01608                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100567046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1224 aa AA seqDB search
MEAGTGKREAIMKLLRPGPAPPPEPALPWPTRPANPPPHQRRLRIISCWGKVSSSHGGRD
IEAVVEEGRRCFGNCGGFPSIVFQLGSAVLQLHAQECGWQWAAPSRANHWGGMFAFELSG
SSEPLMSFNAMDLLTLGWFIVIVFSYPDGLSGRDQPVELLNPTRVNHMPSSVDVTTTLPL
QVAPTVVPMDLRLDHQFSIPVAEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL
SRQHEAQLHEHIKQQQEILAMKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEK
GKESAVASTEVKMKLQEFVLNKKKALAQRNLNHCISNDPRFWYGKTQHSSLDQSSPPQSG
VSGNYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTAL
KKRPLDVTDSACNSAPGSGPSSPNNSSSNISAENGITPSVANIQAENNLAHRLANREGSV
TQLPLYTSPSLPNITLGLPATAPSSGGSGQQDPERLALPSLQQRISIFPGTHIPPYLSST
TVDRDGGNAHNPLLQHMVLLEQPSTQTPLVPGLGALPLHAQSLVGADRLSPSIHKLRQHR
PLGRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKMIPKPNESSRQHES
HPEETEEELREHQAFLEDPYIDRISNQKDIQGLTSMVQVKQEPVESDEDGEFQPELEPGQ
RQAEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASANFPI
SVQEPPCKPQFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRSKCECI
RGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTI
WNEVHSFSAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIS
AKLLQQRLNVNKILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVG
IGPGAGFNVNMAFTGGLDPPMGDTEYMAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPA
PLGGYNLSAKCFGYLTKQLMGLAGGRIILALEGGHDLTAICDASETCVSVLLGNELDPIP
EKVLQQRPNANAVHSIEKVIEIHSKYWHSLQRYASTVSYSLTEAQKCENEEAETVTAMAS
LSVGVKPPPDKKPDEEPMEEDPPL
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggaggccggcaccgggaagcgcgaggcgataatgaagctgctacgccccgggcccgca
cctccaccagagcccgctcttccctggcctaccaggcctgccaacccaccaccacaccag
cgccgcctccgcatcatcagctgctggggcaaagtttcttcttcacatggagggagggat
atagaggcggtggtggaggaagggcggcgctgctttggaaattgtggaggctttccctcg
attgtcttccagttgggctcggctgttctacagcttcatgcccaggagtgcgggtggcaa
tgggctgcaccatcacgggcgaaccactgggggggtatgtttgcttttgagttgtctggt
tcatcagaacctctgatgagctttaatgcgatggacctattgacattgggttggtttatt
gttattgttttttcttatccagatggactttctggcagggaccagccggtagaactgcta
aatccaaccagagtaaatcatatgccaagttcagttgatgtgaccacaacacttcccctg
caagttgcgcccactgtagttcctatggatctccgcttggaccatcagttctccatcccg
gtggccgagcctacgttacgtgaacagcagctccaacaggagcttctggccctcaagcag
aaacagcagatccagagacagatcctcatagcagaattccagagacagcatgaacagctc
tctcggcaacatgaagcacagctgcatgaacacataaagcagcaacaggagattcttgca
atgaaacatcagcaagaactcttggagcaccagagaaaactagaacagcatcggcaggag
caagagttggaaaaacagcatagagaacagaaactgcagcagcttaaaaataaggagaaa
ggaaaagaaagtgcagtggcgagcacagaagtaaaaatgaagttgcaagagtttgtctta
aataaaaaaaaagctttggcacagcggaatctcaaccattgcatttccaatgaccctcga
ttctggtatgggaaaacacaacatagttctctagatcagagttcaccaccacaaagtgga
gtgtcaggcaattacaatcatcctgtcctagggatgtatgattccaaagatgatttcccc
ctcagaaaaacagcatctgaacctaatctcaaattgcgatccagattgaagcagaaggtt
gctgaaaggcgcagtagtcctttattacggagaaaagatgggcctgtagttacagcgctt
aaaaagcgtccattagatgtcacagactcagcatgcaacagtgctcctggatctggccct
agttctccaaacaatagttccagtaatataagtgctgagaatggaattactccatcagtt
gcaaatattcaggctgagaacaacctagctcatagacttgcgaatcgtgaaggctcagta
acacagcttccattgtacacatctccctccttgcccaatataacattaggactgcctgca
actgctccatccagtggtggatcaggacagcaggaccctgaaagacttgctcttccgtca
ttacaacaacgaatctccatatttcctggtactcatattcctccttatttaagcagcacc
acagtggacagagatgggggaaatgcacataaccctcttctccaacatatggtcttactg
gaacaaccatcaacgcaaactcccttagtcccaggactaggggcactccccctccatgcg
cagtccctggtgggtgcggacaggctctctccctccatccacaaactgcggcagcaccgc
cccctggggcgcacgcagtctgctcctctcccccagaatgcacaggccctccagcaatta
gtgatccagcaacagcatcagcagttcctggaaaaacacaaacagcaatttcagcagcag
cagctgcacattaacaagatgataccaaaaccaaacgagtcttcccgtcagcatgaaagt
caccctgaagagactgaagaagagttacgagaacaccaagcgtttttagaagacccatat
attgaccgaatatcaaaccaaaaggacattcaagggttgaccagtatggtccaagtgaag
caagagcctgtggagagtgatgaagatggagagttccaaccagaattagagccaggacag
aggcaagctgagcaggagttgctcttcagacagcaagcccttttgctggagcagcagcgc
attcatcagttgaggaattaccaggcatccatggaggccgctggtatcccagtgtctttt
ggcggacatcggcctctttctcgagcccagtcatcccctgcctctgccaatttccccatt
tctgtacaggagccaccctgcaagccacaattcacaacaggccttgtgtatgacaccttg
atgctgaagcaccagtgtacctgtggaaacacaaacagtcatccagaacatgcaggaaga
atccagagcatttggtcacggcttcaggagacaggccttcgtagcaagtgtgagtgtatt
cgtggaagaaaagcaactctagaagagctacagactgttcattcagaagcccacacacta
ctttatggtaccaaccctctgaacagacaaaaattggacagcaagaaactcttaggctct
ttgacgtcagtgttcgtcaggctcccttgtggtggtgttggagttgacagtgacacaatt
tggaatgaagtccattcattcagcgcagctcgccttgctgttggttgtgtcatagagctt
gtttttaaagttgctacaggagaactgaagaatgggtttgctgtggttcgacctcctggg
caccatgcagaagaaagtacacccatggggttttgctattttaattctgtggcgatttca
gccaagcttctccagcagagattgaatgtgaacaaaatacttattgtggactgggatgtg
caccatggaaatggtactcagcaggctttctacaacgatcctaatgttctttatatttca
ctacatcggtatgatgatggaaacttcttcccaggcagtggtgctcccgatgaggttggc
ataggaccaggtgctggtttcaatgttaatatggcatttactggtggtcttgatcctcca
atgggagacacagaatacatggctgctttcagaacagtagtaatgcctattgctaatgag
tttgctccagatgttgtgctggtatcatcaggctttgatgcagttgaaggtcatcccgca
ccacttggaggatacaatctgtcagcaaaatgctttgggtacctgacaaaacagctcatg
ggtctggctggaggaagaataattctggccctagaaggaggccatgacctgacagctatt
tgtgatgcttctgaaacatgtgtttctgttttgctaggaaatgagcttgatcctattcct
gaaaaggtcttgcagcaaaggccaaatgccaatgcagtgcattccattgaaaaggtcatt
gaaatccacagtaagtactggcactctctccagcgttacgcatcaacagtcagctattct
ttgaccgaggcacagaaatgtgagaatgaagaagcagaaactgtaacagctatggcatca
ctgtcagtgggagtcaagccaccacctgacaaaaagccagacgaggagcccatggaagag
gaccctcccctgtag

DBGET integrated database retrieval system