KEGG   Anolis carolinensis (green anole): 100567048Help
Entry
100567048         CDS       T01608                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:acs04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 449 aa AA seqDB search
MGALGRRGLFLGTVSCTLFLAVNSLYSSSDDVIELTPTNFNREVVQSDNLWLVEFYAPWC
GHCQRLTPEWKKAATALKGVVKIGAVDADKHQSLGGQYGVKGFPTIKIFGANKNKAEDYQ
GARTSDAIVDAALSALRSLVKDRLGGRGGGYSSGKQSSRESGGSGKKDVIELTDDTFDKN
VLDSNDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTNGKVKLAAVDATVNQVVAGRYG
IRGFPTIKIFQKGEDPIDYDGGRTKTDIVARALDLFSENAPPPELFEIINEDVLKQTCDA
HQLCIISVLPHILDTGAAGRNSYLEVMLKLADKYKKKMWGWLWTEAGAQPDLENSLGIGG
FGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVSGGGFSKINTVEPWD
GKDGELPAEEDIDLSDIDLDDWDNEKDEL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgttgggccggagaggtctattcttgggaactgtaagctgcacactctttttg
gctgtcaacagcttgtattcttccagtgacgatgttatagaactaacaccaacaaatttc
aacagggaagttgtacagagtgacaacttatggctggtggaattctatgctccatggtgt
ggtcactgccagaggttgacacctgaatggaagaaagctgccacagctctgaaaggtgtt
gtgaaaattggagctgttgatgctgataaacatcaatccctaggtggccagtatggtgtc
aagggatttcccactatcaagatatttggtgccaataagaacaaagcagaagattatcaa
ggggccagaacaagtgatgctattgttgatgcagctttaagtgctctccggtcactggtc
aaggatcgccttgggggtagaggaggtggctatagttctggaaagcagagcagccgtgaa
agtgggggctcagggaaaaaggacgtgatcgaactgacagatgacacttttgataagaat
gtcctggacagcaatgatgtctggctggtcgagttttatgctccttggtgtggacattgc
aaaaatttagagccagaatgggcagcagctgcaacagaagtgaaagagcaaaccaatggg
aaggtgaaattggctgctgtagatgccacagtgaaccaggtggtagccggtcgatatggg
atccgtgggttccccaccataaagatcttccagaaaggagaagatcccattgattatgat
ggtgggaggacaaaaacagatattgttgctcgtgcactggacttgttctcagagaatgcg
ccgccacctgaactctttgagattattaacgaagatgtgttgaagcaaacttgtgatgcc
caccagctatgtatcatttctgttttgccccatattcttgatacaggagctgcaggaaga
aattcctacttagaagtcatgttgaaattggcagacaagtacaaaaagaagatgtggggg
tggctttggacagaggctggagctcagccagatcttgaaaattccttaggaatcggaggt
tttggatatccagccatggcggcagtgaatgctcgaaagatgaaatttgcattgctgaaa
ggatctttcagtgaacaagggattaatgaattcctcagggaactctctgttggccgagga
tccacagcaccagtaagtggagggggcttttcaaagatcaacacagtagagccctgggat
ggaaaagatggggagctgccagctgaagaagatatcgatctcagtgatatagatcttgat
gactgggacaatgagaaggatgaattgtga

DBGET integrated database retrieval system