KEGG   Anolis carolinensis (green anole): 100567068Help
Entry
100567068         CDS       T01608                                 

Definition
tyrosine-protein phosphatase non-receptor type 7-like
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 364 aa AA seqDB search
MVLACSVCSKINSSSSLQREEVEAGMEKATNKSQEVKKHVRLQDRRGSSVSLVLDMSSLS
NTDPIRSVSTPRDVTVQLLNTASHILSQKMLQEQTWRLEQLQEEFAKIPSNFISPEELDI
PGRAAKDRYRSILPNPQSRVCLKTMRNQEDECYINANYIRGYAGQEKAYIATQGPMLNTV
NDFWTMVWQEESPLIVMLTKLKEEKEKCICYWPDTEATYGSFTIRLQGVCKYDEYTIRNF
TLQLKDKCRDVKHIVFSSWPDQKTPESAKTLLHLICEVEKIQQASENMGPIVVHCSAGIG
RTGCFIAAQIGCQQLKDKGEVDILGIVCQLRIDRGGMIQTSEQYQFLHHTLAMYASQLPE
ITDS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggcttgttcagtatgctccaaaatcaatagttccagcagcctgcaacgtgaa
gaagtggaagcaggaatggagaaggctaccaacaagagtcaggaagttaagaaacatgtg
cggctgcaggatagaaggggctccagtgtgtcactggtcctggacatgagctccttgagc
aacacagatcccattcggtcagtctccactcctagagatgtgacagtgcagctcttgaac
acagccagccacattctttctcaaaaaatgctccaggagcagacctggagactggaacaa
cttcaagaggagtttgcgaaaatcccctcaaactttatcagtcctgaagagctggacatc
cctggacgagctgcaaaggacagatacagatccattttaccaaatcctcagagtcgtgtc
tgtctcaagacaatgaggaaccaagaggatgagtgttacatcaatgcaaattacatccgg
ggttatgctgggcaagagaaggcctacattgctacacaaggaccaatgctaaatacggtg
aatgacttctggacaatggtgtggcaggaagagtctcctctcatagtcatgctcaccaaa
ctcaaggaagagaaagagaaatgcatctgttactggcctgatacagaggcgacatatggg
tctttcaccatccgacttcaaggagtctgcaagtatgatgaatacactatccgtaacttt
accctacagctcaaagacaagtgtcgtgatgtgaagcacattgtcttctcatcatggccg
gaccaaaagaccccagagtcagccaagacacttttgcacttgatttgtgaggtggagaaa
atccagcaggcctcagagaacatggggcctattgtggtgcattgtagtgcaggaattggc
cggactggctgctttattgctgcacagattggatgccagcaactgaaggacaaaggagag
gtagacattttggggatagtttgtcagctccgcatagacagaggtggaatgatacaaacc
agtgaacaataccagttcctccatcatacattagcaatgtatgcttcacagcttcctgag
atcacagactcttga

DBGET integrated database retrieval system