KEGG   Anolis carolinensis (green anole): 100567116Help
Entry
100567116         CDS       T01608                                 

Definition
calpain-1 catalytic subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100567116
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100567116
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100567116
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C2: calpain family
   100567116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 705 aa AA seqDB search
MMPFGGMAARLERDRLRAEGVGSHQNAVKYLGQDYETLKQECLESGRLFEDPQFPAIPSV
LGFKELGPNSGKTQGVRWKRPSEIVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDRLPTKDGELVFVHSAECQEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVAEMYDLKKPPRNIAQIICKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGFKNVDYRGQQESLIRIRNPWGQVEWTGAW
SDSSSEWNEVDPDQREELHLKMEDGEFWMSFREFMRQFSRLEICNLTPDALDKDGLSRWH
TTLFEGTWRRGSTAGGCRNHPATFWINPQFKIKLLEEDDDPEDDEVACTFLVALMQKHRR
KARRVGEDMHTIGFAVYEVPEEAQGCQNVHLKKDFFLRNQSQARSETFINLREVSNHIRL
PPGEYIIVPSTFEPNKEADFVLRVFTEKQSDAEELDEEISADLPDEEEISEDDVDENFKN
MFRQLAGEDMEISVFELRTVLNRVIARHKDLKTDGFSMDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLNIFRQHDLDKSGTMSAYEMRLALETAGFKLDNKLHQVLVARYADDSLG
VDFDNFVSCLVKLETMFRFFQSMDPEGTGSAVMNLGEWLTFTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggaggaatggctgccagactagaaagggaccgtctgcgagcagagggc
gtgggcagtcaccaaaatgctgttaaatacctgggtcaggattacgaaaccctgaagcag
gaatgtttggagagtggccgattgtttgaagatccccagtttcctgccatcccttctgtc
cttggcttcaaggaactggggccaaattctggcaagacccaaggagtgcgttggaagcgc
ccatcggaaattgtggatgacccacagtttattgtgggaggtgctacaaggacagatatc
tgccaaggggctctgggtgattgctggttactggctgccattggctccctgactctcaat
gaggatcttctgcaccgagttgtgcctcatggccagagcttccaggaggactatgcaggc
atcttccacttccagatctggcaatttggtgaatgggtggatgtggtagttgatgaccgc
ctgcccactaaagatggagagctggtatttgtgcattcagcagaatgtcaagagttctgg
agtgctctgctagaaaaggcatatgctaagttgaatggctcttatgaggccctgtcaggt
ggcagcaccacagaaggctttgaggacttcacaggaggcgtagccgaaatgtacgatctt
aagaagccacctaggaacattgctcagatcatttgcaaggctctcgaaaggggttccctc
cttggctgttccattgatatcaccagtgcatttgatatggaagcagttactttcaagaaa
ctagtgaaaggtcatgcctattctgtcacaggatttaagaatgtggactatcgtggccaa
caagaatcactcatccgcataaggaatccctggggtcaggtggagtggactggagcctgg
agtgacagctcttctgagtggaatgaagtggaccctgatcagagggaagaactgcatcta
aaaatggaagatggtgaattctggatgtcttttcgagaatttatgcgtcagttttccagg
ctggaaatctgtaacctcaccccagatgctctggacaaggatgggttaagcagatggcac
accaccctctttgagggaacctggcgccgtggcagcacagctggaggttgcaggaaccat
ccagcaacattctggattaatccacagttcaaaatcaagctcctagaagaggatgatgac
ccagaagatgatgaggtggcttgcactttcttagttgccttgatgcaaaaacatcgccga
aaagctcgccgagttggagaagatatgcataccatcggctttgctgtctatgaggttcct
gaggaggcacagggctgccaaaatgtccacctgaagaaggatttctttctgagaaaccag
tctcaggctcgctcagaaacctttatcaacctgcgggaggtgagcaaccatatccgcctg
cctcctggtgaatacatcatcgtgccctccaccttcgagcccaacaaggaagcagacttt
gtcctgcgtgtcttcacagaaaagcagtctgatgcagaggaactggatgaggagatctct
gcagatcttccagatgaggaagaaatctctgaggacgatgtagatgagaacttcaaaaac
atgttccgtcagcttgcaggagaggacatggaaatcagtgtctttgagctcagaactgtc
ctgaacagagtcattgccaggcacaaagacctgaagacagatgggttcagcatggattct
tgccgcaacatggtcaacctaatggataaagatggcagtgctcgtctgggacttgtggag
tttcagatcttgtggaacaagatcaggagctggctgaatatatttcgtcagcatgatttg
gataagtcaggcaccatgagcgcctatgagatgcgtctggccttagaaacagctggattc
aaactggacaacaagttgcatcaagtgctggtggcccgatatgctgacgactcattgggt
gtggattttgataactttgtctcctgtttagtgaagctggagaccatgttcaggttcttc
caaagcatggatcctgaaggtactggcagtgcagtgatgaaccttggtgagtggctgaca
ttcacaatgtgcggctag

DBGET integrated database retrieval system