KEGG   Anolis carolinensis (green anole): 100567116Help
Entry
100567116         CDS       T01608                                 

Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100567116
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100567116
   04217 Necroptosis
    100567116
   04218 Cellular senescence
    100567116
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100567116
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C2: calpain family
   100567116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 705 aa AA seqDB search
MMPFGGMAARLERDRLRAEGVGSHQNAVKYLGQDYETLKQECLESGRLFEDPQFPAIPSV
LGFKELGPNSGKTQGVRWKRPSEIVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EDLLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDRLPTKDGELVFVHSAECQEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVAEMYDLKKPPRNIAQIICKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGFKNVDYRGQQESLIRIRNPWGQVEWTGAW
SDSSSEWNEVDPDQREELHLKMEDGEFWMSFREFMRQFSRLEICNLTPDALDKDGLSRWH
TTLFEGTWRRGSTAGGCRNHPATFWINPQFKIKLLEEDDDPEDDEVACTFLVALMQKHRR
KARRVGEDMHTIGFAVYEVPEEAQGCQNVHLKKDFFLRNQSQARSETFINLREVSNHIRL
PPGEYIIVPSTFEPNKEADFVLRVFTEKQSDAEELDEEISADLPDEEEISEDDVDENFKN
MFRQLAGEDMEISVFELRTVLNRVIARHKDLKTDGFSMDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLNIFRQHDLDKSGTMSAYEMRLALETAGFKLDNKLHQVLVARYADDSLG
VDFDNFVSCLVKLETMFRFFQSMDPEGTGSAVMNLGEWLTFTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggaggaatggctgccagactagaaagggaccgtctgcgagcagagggc
gtgggcagtcaccaaaatgctgttaaatacctgggtcaggattacgaaaccctgaagcag
gaatgtttggagagtggccgattgtttgaagatccccagtttcctgccatcccttctgtc
cttggcttcaaggaactggggccaaattctggcaagacccaaggagtgcgttggaagcgc
ccatcggaaattgtggatgacccacagtttattgtgggaggtgctacaaggacagatatc
tgccaaggggctctgggtgattgctggttactggctgccattggctccctgactctcaat
gaggatcttctgcaccgagttgtgcctcatggccagagcttccaggaggactatgcaggc
atcttccacttccagatctggcaatttggtgaatgggtggatgtggtagttgatgaccgc
ctgcccactaaagatggagagctggtatttgtgcattcagcagaatgtcaagagttctgg
agtgctctgctagaaaaggcatatgctaagttgaatggctcttatgaggccctgtcaggt
ggcagcaccacagaaggctttgaggacttcacaggaggcgtagccgaaatgtacgatctt
aagaagccacctaggaacattgctcagatcatttgcaaggctctcgaaaggggttccctc
cttggctgttccattgatatcaccagtgcatttgatatggaagcagttactttcaagaaa
ctagtgaaaggtcatgcctattctgtcacaggatttaagaatgtggactatcgtggccaa
caagaatcactcatccgcataaggaatccctggggtcaggtggagtggactggagcctgg
agtgacagctcttctgagtggaatgaagtggaccctgatcagagggaagaactgcatcta
aaaatggaagatggtgaattctggatgtcttttcgagaatttatgcgtcagttttccagg
ctggaaatctgtaacctcaccccagatgctctggacaaggatgggttaagcagatggcac
accaccctctttgagggaacctggcgccgtggcagcacagctggaggttgcaggaaccat
ccagcaacattctggattaatccacagttcaaaatcaagctcctagaagaggatgatgac
ccagaagatgatgaggtggcttgcactttcttagttgccttgatgcaaaaacatcgccga
aaagctcgccgagttggagaagatatgcataccatcggctttgctgtctatgaggttcct
gaggaggcacagggctgccaaaatgtccacctgaagaaggatttctttctgagaaaccag
tctcaggctcgctcagaaacctttatcaacctgcgggaggtgagcaaccatatccgcctg
cctcctggtgaatacatcatcgtgccctccaccttcgagcccaacaaggaagcagacttt
gtcctgcgtgtcttcacagaaaagcagtctgatgcagaggaactggatgaggagatctct
gcagatcttccagatgaggaagaaatctctgaggacgatgtagatgagaacttcaaaaac
atgttccgtcagcttgcaggagaggacatggaaatcagtgtctttgagctcagaactgtc
ctgaacagagtcattgccaggcacaaagacctgaagacagatgggttcagcatggattct
tgccgcaacatggtcaacctaatggataaagatggcagtgctcgtctgggacttgtggag
tttcagatcttgtggaacaagatcaggagctggctgaatatatttcgtcagcatgatttg
gataagtcaggcaccatgagcgcctatgagatgcgtctggccttagaaacagctggattc
aaactggacaacaagttgcatcaagtgctggtggcccgatatgctgacgactcattgggt
gtggattttgataactttgtctcctgtttagtgaagctggagaccatgttcaggttcttc
caaagcatggatcctgaaggtactggcagtgcagtgatgaaccttggtgagtggctgaca
ttcacaatgtgcggctag

DBGET integrated database retrieval system