KEGG   Anolis carolinensis (green anole): 100567176Help
Entry
100567176         CDS       T01608                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100567176
   04012 ErbB signaling pathway
    100567176
   04370 VEGF signaling pathway
    100567176
   04068 FoxO signaling pathway
    100567176
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100567176
  Cell communication
   04540 Gap junction
    100567176
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100567176
  Endocrine system
   04910 Insulin signaling pathway
    100567176
   04912 GnRH signaling pathway
    100567176
   04916 Melanogenesis
    100567176
  Circulatory system
   04270 Vascular smooth muscle contraction
    100567176
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100567176
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100567176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
AHLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQH
KPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMD
GGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLC
DFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPD
AKELEVIFGRPVLDGGGDAELHSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPP
PKLPTGVFTQDFQEFVNK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
agcgcacctcgtcgacctccagaagaagctggaagagctggagctggacgagcagcagaa
gaagcggctggaggccttcctgacgcagaaggccaaagtcggggagctgaaagatgacga
cttcgagaggatttcggagctgggcgccggcaacggcggggtggtcaccaaagtacaaca
caaaccctcagggctcatcatggcgaggaagctgatccacttggagatcaagcccgccat
ccggaaccagatcatccgcgagctccaggtgctccacgagtgcaactcgccgtacatcgt
gggcttctacggcgctttctacagcgacggggagatcagcatctgcatggagcacatgga
cggaggttccctcgaccaagtcctgaaggaagccaagaggatccctgaagagatcctggg
gaaagtcagcatcgcggtcctgcgagggctggcctacctgcgagagaagcaccagatcat
gcacagagacgtgaagccttcgaacatcctggtgaattctcggggggagatcaagctctg
cgacttcggggtcagcggccagctcatcgactccatggccaactccttcgtgggcacacg
ctcctatatgtccccggagcgccttcagggcacacactactcggtgcagtcggacatctg
gagcatgggcctctcgctggtggagctgtccatcgggaggtaccccatccccccgccgga
cgccaaggagctggaggtcatctttggccggcccgtcctggacggagggggagacgccga
gctccacagcatctccccccgaccacggccccccggccggcccatcagcggacacgggat
ggacagccgccccgccatggccatctttgaattgctggactacattgtgaatgagccgcc
cccgaagctgccgaccggggttttcacacaggacttccaagagtttgtaaataaatg

DBGET integrated database retrieval system