KEGG   Anolis carolinensis (green anole): 100567176Help
Entry
100567176         CDS       T01608                                 

Gene name
map2k2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04270  Vascular smooth muscle contraction
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04540  Gap junction
acs04620  Toll-like receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04916  Melanogenesis
Module
acs_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100567176 (map2k2)
   04012 ErbB signaling pathway
    100567176 (map2k2)
   04370 VEGF signaling pathway
    100567176 (map2k2)
   04371 Apelin signaling pathway
    100567176 (map2k2)
   04068 FoxO signaling pathway
    100567176 (map2k2)
   04150 mTOR signaling pathway
    100567176 (map2k2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100567176 (map2k2)
  Cell growth and death
   04210 Apoptosis
    100567176 (map2k2)
   04218 Cellular senescence
    100567176 (map2k2)
  Cellular community - eukaryotes
   04540 Gap junction
    100567176 (map2k2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100567176 (map2k2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100567176 (map2k2)
  Endocrine system
   04910 Insulin signaling pathway
    100567176 (map2k2)
   04912 GnRH signaling pathway
    100567176 (map2k2)
   04916 Melanogenesis
    100567176 (map2k2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100567176 (map2k2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100567176 (map2k2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: STE group
  STE7 family
   100567176 (map2k2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7 DUF3216 Kdo
Motif
Other DBs
NCBI-GeneID: 100567176
NCBI-ProteinID: XP_003230613
Ensembl: ENSACAG00000000286
Position
Un
AA seq 412 aa AA seqDB search
MGKETTSWVSINWHVVYLRVSSGNVVFEGEARPEFSQWFSLRAHLVDLQKKLEELELDEQ
QKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHKPSGLIMARKLIHLEIKP
AIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEI
LGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVG
TRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEVIFGRPVLDGGGD
AELHSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPTGVFTQDFQEFVNK
CLIKNPAERADLKMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagaaacgacttcatgggtgtctattaattggcatgttgtttacctgagagtg
agttcaggcaacgtagtgtttgagggagaagctaggcctgagttttcccaatggttctcc
ctcagagcgcacctcgtcgacctccagaagaagctggaagagctggagctggacgagcag
cagaagaagcggctggaggccttcctgacgcagaaggccaaagtcggggagctgaaagat
gacgacttcgagaggatttcggagctgggcgccggcaacggcggggtggtcaccaaagta
caacacaaaccctcagggctcatcatggcgaggaagctgatccacttggagatcaagccc
gccatccggaaccagatcatccgcgagctccaggtgctccacgagtgcaactcgccgtac
atcgtgggcttctacggcgctttctacagcgacggggagatcagcatctgcatggagcac
atggacggaggttccctcgaccaagtcctgaaggaagccaagaggatccctgaagagatc
ctggggaaagtcagcatcgcggtcctgcgagggctggcctacctgcgagagaagcaccag
atcatgcacagagacgtgaagccttcgaacatcctggtgaattctcggggggagatcaag
ctctgcgacttcggggtcagcggccagctcatcgactccatggccaactccttcgtgggc
acacgctcctatatgtccccggagcgccttcagggcacacactactcggtgcagtcggac
atctggagcatgggcctctcgctggtggagctgtccatcgggaggtaccccatccccccg
ccggacgccaaggagctggaggtcatctttggccggcccgtcctggacggagggggagac
gccgagctccacagcatctccccccgaccacggccccccggccggcccatcagcggacac
gggatggacagccgccccgccatggccatctttgaattgctggactacattgtgaatgag
ccgcccccgaagctgccgaccggggttttcacacaggacttccaagagtttgtaaataaa
tgcttaattaaaaaccccgccgaacgggcagatctcaagatgctgatgaaccatgccttt
atcaaacgctcggaggtggaggaggtggacttcgcgggctggctctgcaagacgctgcgc
ctgaaccagcccagcacgcccacccgcaccgccatgtga

DBGET integrated database retrieval system