KEGG   Anolis carolinensis (green anole): 100567199Help
Entry
100567199         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 44-A-like
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 698 aa AA seqDB search
MDKCKHVGRLRLAQDHSIVNPQKWHCMVCNTTESVWACLSCSHVACGRYIEEHALKHFQE
SNHPVALEVNELYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYDCTTRSGRTLRSM
GSSDDLSHNNAQAVLRNQDRMFTALWHRRHALMGKVFRSWFELTPNGKRVLEEEKLREEA
EERRLNARKRREERKRQLKEEMEKMPPRKSFRLQNQNRKSSKIPRCALKMSQNVDSPVEL
KVTATSDEVKLKKNNDSPMKRRPTMTPGVTGLRNLGNTCYMNSILQVLSHLLIFRECFLK
LDLNQTQELLAAAANGKTRSSSKHPPSPGSIFHLNKSHIKGKESYARRTSVASGLSGGAS
NRRNMELIQPKEPSSKYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQ
QDAQEFLCELLDKVQQELETARTKCPALIPTSQRKLIKQVLNVVNTIFHGQLLSQVTCLA
CDNKSNTIEPFWDLSLEFPERYHCNGKETTCQYPCMLTEMLAKFTETEALEGKIYACDQC
NKAQKQLMVCQLPQVLRLHLKRFRWSGRNHREKIGVHVTFSQILNMEPYCCRESLKSLVP
DCFIYDLSAVVMHHGKGFGSGHYTAYCYNSDGGFWVHCNDSKLNMCTMEEVCKAQAYILF
YTQRVIQAVRPSPVSGLDSPSGRQPNTEVNCSSTGSNS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggataagtgtaagcatgtaggacgtcttcgacttgcccaagatcattccattgtgaac
cctcagaaatggcattgcatggtttgcaatactacagaatctgtatgggcctgcctcagt
tgctcacatgttgcttgtggaagatatattgaagaacatgcactaaagcactttcaagaa
agtaatcatccagtggcattggaagtgaatgagctgtatgttttctgctacctttgtgat
gactatgttcttaatgataatgcaactggtgacctaaaactcttgcgaagtacattaagt
gcaatcaagagtcaaaattatgactgtactactcgcagtggcaggactttgcgatcaatg
ggctcaagtgatgatctttcgcataataatgcgcaagctgtgcttcgtaatcaagatcgt
atgttcacagctctgtggcacagaaggcatgcattaatgggcaaagtgtttagatcttgg
tttgaactgacaccaaatggaaaaagagttttggaagaagagaagctaagagaagaggca
gaagaaagacgacttaatgctaggaagagaagagaagaacgaaagcggcagttgaaggaa
gaaatggaaaaaatgcctccaagaaagagctttcgtttgcagaatcaaaatagaaaatcc
tcaaaaattccacgctgtgcactaaaaatgtcacaaaatgtagactctcctgtagagctg
aaagtaacagctacctcagatgaagtaaaattaaaaaaaaataatgactctccaatgaaa
agaaggcctactatgactcctggtgtaacaggattgcgaaacttgggaaatacgtgctat
atgaattctattcttcaggtattgagtcacttgctcatatttcgggaatgttttttaaag
cttgatttgaaccaaactcaagagttgttagcagctgcagccaatggcaaaacaagatca
tcttctaagcatcctccatctcctggctctatttttcatttgaacaaaagccatattaaa
ggcaaggaatcttatgcaaggcgaactagtgtggcatcaggcttaagtgggggagcatca
aacaggagaaatatggaacttattcaaccaaaggagccaagctcaaagtacatctctctt
tgtcatgagctgcatactttgtttcaagtgatgtggtctggcaagtgggctttagtgtct
ccttttgccatgctccattcggtatggagactaatcccagcgtttcgtggttatgcccaa
caagatgctcaggaatttctttgtgaacttttggataaagtacagcaagaactggagaca
gctcggacaaaatgcccagctctcattcccacttctcaaaggaaactcattaagcaggtt
ttgaacgtggttaataccatttttcatgggcagcttttaagtcaggtaacatgtcttgct
tgtgataataaatcaaatactattgaacccttctgggatctctcactggaatttcctgaa
agataccactgcaatgggaaggagacaacctgtcagtatccatgcatgttgacagaaatg
ttggccaagtttacagaaacagaagccttggaagggaagatatatgcctgtgatcagtgc
aacaaagcacaaaaacagcttatggtatgccagctacctcaagttctgcggttacacctt
aagcggttcagatggtcaggacgcaatcaccgtgagaagattggtgtacatgtcaccttc
agtcagatactaaacatggagccctattgctgcagagaatccctgaagtcccttgttcca
gactgctttatctatgacttgtctgctgtggtgatgcatcatggaaaaggatttggatca
ggacattacactgcctattgctacaattcagatggaggattctgggtacactgcaatgat
tccaagctcaacatgtgcactatggaagaagtatgcaaggcccaggcgtacattttgttt
tatacccagcgagttattcaggcagttaggccctctcctgtatcaggtcttgactcacca
tctggaaggcagccaaatactgaggttaactgttccagtacaggcagtaacagctaa

DBGET integrated database retrieval system